KEGG   Saccharomyces cerevisiae (budding yeast): YBR038WHelp
Entry
YBR038W           CDS       T00005                                 

Gene name
CHS2
Definition
(RefSeq) chitin synthase CHS2
  KO
K00698  chitin synthase [EC:2.4.1.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YBR038W (CHS2)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.16  chitin synthase
     YBR038W (CHS2)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Structural polysaccharide
   YBR038W (CHS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chitin_synth_1 Chitin_synth_2 Chitin_synth_1N Glyco_tranf_2_3 Glyco_trans_2_3 Ant_C
Motif
Other DBs
NCBI-GeneID: 852326
NCBI-ProteinID: NP_009594
SGD: S000000242
UniProt: P14180
Position
II:311898..314789
Genome map
AA seq 963 aa AA seqDB search
MTRNPFMVEPSNGSPNRRGASNLSKFYANANSNSRWANPSEESLEDSYDQSNVFQGLPAS
PSRAALRYSPDRRHRTQFYRDSAHNSPVAPNRYAANLQESPKRAGEAVIHLSEGSNLYPR
DNADLPVDPYHLSPQQQPSNNLFGSGRLYSQSSKYTMSTTSTTAPSLAEADDEKEKYLTS
TTSYDDQSTIFSADTFNETKFELNHPTRQQYVRRANSESKRRMVSDLPPPSKKKALLKLD
NPIPKGLLDTLPRRNSPEFTEMRYTACTVEPDDFLREGYTLRFAEMNRECQIAICITMYN
EDKYSLARTIHSIMKNVAHLCKREKSHVWGPNGWKKVSVILISDGRAKVNQGSLDYLAAL
GVYQEDMAKASVNGDPVKAHIFELTTQVSINADLDYVSKDIVPVQLVFCLKEENKKKINS
HRWLFNAFCPVLQPTVVTLVDVGTRLNNTAIYRLWKVFDMDSNVAGAAGQIKTMKGKWGL
KLFNPLVASQNFEYKISNILDKPLESVFGYISVLPGALSAYRYRALKNHEDGTGPLRSYF
LGETQEGRDHDVFTANMYLAEDRILCWELVAKRDAKWVLKYVKEATGETDVPEDVSEFIS
QRRRWLNGAMFAAIYAQLHFYQIWKTKHSVVRKFFLHVEFLYQFIQMLFSWFSIANFVLT
FYYLAGSMNLVIKHGEALFIFFKYLIFCDLASLFIISMGNRPQGAKHLFITSMVILSICA
TYSLICGFVFAFKSLASGTESHKIFVDIVISLLSTYGLYFFSSLMYLDPWHMFTSSIQYF
LTLPAFTCTLQIFAFCNTHDVSWGTKGSTQESKQLSKAIVVQGPDGKQIVETDWPQEVDK
KFLEIKSRLKEPEFEESSGNEKQSKNDYYRDIRTRIVMIWMLSNLILIMSIIQVFTPQDT
DNGYLIFILWSVAALAAFRVVGSMAFLFMKYLRIIVSYRNKVEGSGSWEVSKLDLPNVFH
KKG
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaaacccgtttatggtggaaccttcgaatggctctcctaatagacgtggtgct
tcaaacctctccaaattttacgcaaacgctaacagcaactctcggtgggctaatcccagt
gaggagagtttggaggatagctatgaccaatctaacgttttccaaggccttccggcatct
ccttcgagagctgcactaagatactccccagaccgtcgccatagaactcaattttaccgc
gatagtgcccataactctccagttgctccgaacaggtatgctgctaatctacaagagtct
cccaaaagagcaggcgaggctgtcatacatctaagtgaggggagtaacctttacccccgc
gataatgcagatctaccggtagacccctaccatctatcaccccagcaacagcccagtaac
aatctgtttggaagtggcagattgtattctcaaagctcgaaatacacgatgtctactact
tccacaacggctccctctctggcagaagcagacgatgaaaaggaaaaatacctcacttcg
actacttcctatgatgatcagtctacaattttctctgcagacactttcaatgaaacaaaa
tttgaactgaaccatccaacaagacagcagtatgtaagacgtgccaattctgagagtaag
agaagaatggtctcagacttgcctcccccaagcaagaagaaggcactattgaaactagac
aacccgataccaaaaggtctgttggatactttgcctcgtaggaactcccctgagtttacg
gaaatgagatatacagcctgcactgtggaacctgacgattttttgagagaaggttacact
ttgagattcgcagagatgaacagagaatgtcaaattgccatttgtattaccatgtacaat
gaagataaatattcattggcaagaaccatccactccattatgaagaatgttgctcatctt
tgtaagcgtgaaaaatctcatgtttggggccccaatggctggaagaaagtctctgtaatt
ctgattagtgacggtagagcaaaagtcaaccaagggtctctcgactatttagctgctttg
ggtgtttatcaagaagatatggccaaggcgtctgtgaatggtgatccggtaaaagcgcac
atttttgaattgacaactcaggtctctatcaacgccgatctggattatgtttcaaaggac
attgttcctgtgcaattggttttttgtctaaaagaagaaaataagaaaaagatcaattcc
catcgttggctattcaacgcgttttgtcccgttttgcaacctactgtagttactttggtt
gatgtcggtacacgtttaaacaatacagcaatttacaggttatggaaggtttttgatatg
gattcaaatgtggctggtgcggctggtcagattaagactatgaaggggaagtggggactg
aaacttttcaatccattagttgcatcgcaaaattttgaatataagatctcgaatatttta
gataaaccattagaaagtgtttttggttatatctctgttcttcctggtgccctgtccgca
tataggtatagagccttaaaaaatcatgaagatggcactggccctctcagatcgtatttc
cttggtgaaactcaagaaggcagagaccatgatgttttcactgcaaatatgtacttggct
gaagatagaattctttgttgggaattggtcgccaagcgagatgcaaaatgggttctaaaa
tatgttaaggaagccactggtgaaacggatgttcccgaagacgtttctgaatttatttct
caaagaagacgttggttaaatggtgcaatgtttgccgcaatttatgctcaattgcatttc
taccaaatttggaaaactaaacattctgttgtacgcaagttctttcttcatgttgaattc
ctttatcaatttattcagatgcttttttcctggttttctattgcaaatttcgttcttacc
ttttattatttagcaggatcaatgaatttagttattaaacatggtgaggccttattcatt
ttttttaaatacctgatcttttgtgacttggcaagtttattcattatttccatgggtaat
agaccccagggcgcgaaacatttattcattacctccatggttatactgtctatatgtgcc
acatattctctaatttgtgggtttgtttttgctttcaagtcgttagcttctggaacggaa
tcccacaaaatatttgtcgacatcgttatctcattgctctccacctatggcctatacttt
ttctcatcactgatgtacctagatccttggcacatgtttacatcatccatacaatacttt
ttgacacttcccgcctttacgtgtactttacagatttttgccttctgtaatacacacgac
gtttcctggggtactaaaggttccacacaggagtccaagcaattgtccaaggccattgtc
gttcaaggtccagatgggaaacagattgtggaaacagattggcctcaggaagttgataag
aagtttttggaaataaaaagtcgtttgaaagaaccagaatttgaagaatcaagcggcaat
gaaaaacaatccaagaatgattattatagagatataagaaccagaattgtgatgatttgg
atgctatcaaatctaatactgatcatgtctataattcaagtctttacaccacaagatact
gacaatggttatttgatattcattttatggtctgtggccgctttagctgcctttagggtg
gttggttccatggcctttttgttcatgaaatacttgcgtataatagtgagttacagaaat
aaagttgaaggtagcggctcatgggaagtctctaaattagacttaccaaatgttttccac
aaaaagggctaa

DBGET integrated database retrieval system