KEGG   Saccharomyces cerevisiae (budding yeast): YBR023CHelp
Entry
YBR023C           CDS       T00005                                 

Gene name
CHS3, CAL1, CSD2, DIT101, KTI2
Definition
chitin synthase CHS3 (EC:2.4.1.16)
Orthology
K00698  
chitin synthase [EC:2.4.1.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YBR023C (CHS3)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.16  chitin synthase
     YBR023C (CHS3)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Structural polysaccharide
   YBR023C (CHS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(284428..287925)
Genome map
AA seq 1165 aa AA seqDB search
MTGLNGDDPDDYYLNLNQDEESLLRSRHSVGSGAPHRQGSLVRPERSRLNNPDNPHFYYA
QKTQEQMNHLDVLPSSTGVNPNATRRSGSLRSKGSVRSKFSGRETDSYLLQDMNTTDKKA
SVKISDEGVAEDEFDKDGDVDNFEESSTQPINKSIKPLRKETNDTLSFWQMYCYFITFWA
PAPILAFCGMPKKERQMAWREKVALISVILYIGAIVAFLTFGFTKTVCSSSKLRLKNNEV
STEFVVINGKAYELDTSSRSGIQDVEVDSDTLYGPWSDAGKDASFLFQNVNGNCHNLITP
KSNSSIPHDDDNNLAWYFPCKLKNQDGSSKPNFTVENYAGWNCHTSKEDRDAFYGLKSKA
DVYFTWDGIKNSSRNLIVYNGDVLDLDLLDWLEKDDVDYPVVFDDLKTSNLQGYDLSLVL
SNGHERKIARCLSEIIKVGEVDSKTVGCIASDVVLYVSLVFILSVVIIKFIIACYFRWTV
ARKQGAYIVDNKTMDKHTNDIEDWSNNIQTKAPLKEVDPHLRPKKYSKKSLGHKRASTFD
LLKKHSSKMFQFNESVIDLDTSMSSSLQSSGSYRGMTTMTTQNAWKLSNENKAVHSRNPS
TLLPTSSMFWNKATSSPVPGSSLIQSLDSTIIHPDIVQQPPLDFMPYGFPLIHTICFVTC
YSEDEEGLRTTLDSLSTTDYPNSHKLLMVVCDGLIKGSGNDKTTPEIALGMMDDFVTPPD
EVKPYSYVAVASGSKRHNMAKIYAGFYKYDDSTIPPENQQRVPIITIVKCGTPAEQGAAK
PGNRGKRDSQIILMSFLEKITFDERMTQLEFQLLKNIWQITGLMADFYETVLMVDADTKV
FPDALTHMVAEMVKDPLIMGLCGETKIANKAQSWVTAIQVFEYYISHHQAKAFESVFGSV
TCLPGCFSMYRIKSPKGSDGYWVPVLANPDIVERYSDNVTNTLHKKNLLLLGEDRFLSSL
MLKTFPKRKQVFVPKAACKTIAPDKFKVLLSQRRRWINSTVHNLFELVLIRDLCGTFCFS
MQFVIGIELIGTMVLPLAICFTIYVIIFAIVSKPTPVITLVLLAIILGLPGLIVVITATR
WSYLWWMCVYICALPIWNFVLPSYAYWKFDDFSWGDTRTIAGGNKKAQDENEGEFDHSKI
KMRTWREFEREDILNRKEESDSFVA
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcttgaatggagatgatcctgatgactactatctgaaccttaatcaagatgaa
gagtctctacttaggtcaagacacagtgtcggctcaggagcacctcatagacaaggctct
ttagtgcggcccgaaagaagccgactgaacaatcctgataatccacatttttattatgcg
cagaaaacgcaggagcagatgaatcacctggatgttttaccatcaagtaccggtgtaaac
ccaaatgcaactcgtcggagtggctccctgcgctccaaaggctcagtgagaagcaaattt
agtggccgcgaaacggatagctatcttttacaagatatgaatactactgacaagaaggct
tccgttaaaataagtgatgaaggtgttgcggaagacgaatttgataaagatggtgatgtg
gacaatttcgaagaaagctccacgcagcccataaataagtctatcaaaccattaagaaag
gaaacgaatgatacattgtcattttggcagatgtactgttatttcattacgttttgggca
cctgctccaattcttgctttctgcgggatgccaaagaaggaaagacaaatggcgtggaga
gaaaaggttgctttaatttctgtcatcttgtacattggtgcgattgtggctttcctgact
tttggtttcactaaaaccgtttgtagtagttcgaaactacgtttgaaaaacaacgaagta
tcaacagaatttgtcgtaattaacggtaaggcttatgaattggatacttcctcgcgttcc
ggtatacaagacgttgaagtagattcagacaccctttatgggccctggtcagatgctggt
aaagatgcttcgttcttgtttcaaaatgtgaatggtaactgtcataaccttataactcca
aagagtaattcttccattccccatgacgatgataataatttagcatggtattttccttgt
aagttaaagaatcaagatggctcttcgaagccaaacttcacagttgaaaattacgcagga
tggaactgtcatacgtctaaagaagatagggacgcattttacggtttaaagtcgaaagct
gatgtttacttcacttgggatggtataaagaactcttctagaaacttgattgtttataat
ggcgacgttttggatttagatcttcttgattggttggaaaaggatgacgttgactatccc
gttgtattcgatgacttgaagacttcaaatttacaaggttatgatctttcgttggttttg
tcaaatgggcatgaaagaaaaattgcgagatgtttgagcgaaattattaaagttggtgaa
gtagactccaaaaccgtcggttgtattgcctctgatgtcgttttgtatgtttctctggta
tttattctttcagtggtgataattaaattcataattgcctgctacttccgttggactgta
gctaggaaacaaggtgcatatatcgtggacaataaaacaatggataaacacacaaacgat
atcgaggattggtctaataatattcaaacaaaagctcctctaaaggaagtagatcctcat
ttgaggccaaagaaatactcaaaaaagtcgttgggacacaagcgtgcttcaacctttgac
ttgctgaaaaaacacagctccaaaatgtttcaatttaacgaatctgtgatagatctagac
acctccatgagcagttcactacaatcttctggttcatacagaggaatgacaacaatgacc
actcaaaatgcttggaaactctcgaatgaaaacaaagctgtacattcccgtaatccatct
actttgttgcctacatcctcgatgttttggaataaagcgacttcctctcctgtaccagga
tcatcgctgattcagagtcttgattcgacgattatacatcccgatatcgttcaacaacca
ccactggattttatgccatacgggttcccattgattcatactatctgttttgttacttgt
tattctgaggatgaagagggtttaagaaccactttagactctctttctaccacagattat
ccaaattcccataaactactgatggttgtttgtgatggtttaattaagggctcgggcaac
gataagactactccagagatagcgttaggaatgatggacgactttgtcaccccacctgat
gaagttaaaccttactcctatgtggcagtggcatcaggctctaaaagacacaatatggcc
aagatatatgcgggtttttacaaatatgacgattctacaattccaccagaaaatcaacaa
cgtgtcccaatcattacaattgtgaagtgcggtactcctgcagagcagggggccgccaaa
cccggtaacagaggtaagcgtgattctcaaattattctgatgtcctttttagaaaaaata
acatttgatgaaagaatgactcaattggaatttcagcttttaaaaaatatttggcagatt
acggggctaatggcagacttctacgaaacggtacttatggttgatgctgatactaaagtc
tttcccgatgctttaactcatatggtcgctgaaatggttaaagatcctttgattatgggt
ctttgtggtgagaccaagatcgctaataaggcacaatcttgggtaactgcaattcaagtg
tttgagtactatatttcgcatcatcaggctaaagcttttgaatctgtcttcggttcggta
acttgtttgccgggatgtttctcaatgtatcgtataaaatctcctaaaggttcagatggt
tattgggtacctgtattggcaaatccagatattgttgaaagatattcggataatgttaca
aacactttgcataagaagaacttattattacttggtgaagatagatttttatcttcatta
atgttaaagactttccctaagagaaagcaagtatttgttccaaaagctgcttgtaaaact
attgcccctgataaattcaaagtcttactttcccagcgtcgaagatggattaattctacg
gtacataacctttttgaattagttctaatcagagacttatgtggcactttctgtttttcc
atgcaatttgtgattggtattgaattgattggtactatggtactgccgttagccatttgc
tttactatttatgtcattatttttgccattgtatcaaaacctacacccgtaatcacttta
gttttactggcaattattcttggtctgcccggcttaattgttgttataactgctacgaga
tggtcgtacctatggtggatgtgcgtatatatttgtgctttgcctatttggaatttcgta
ctaccttcatatgcgtactggaaatttgatgacttctcatggggtgatacgagaactatt
gcgggaggtaataaaaaggcacaagacgagaatgaaggtgaatttgatcactcaaagatt
aaaatgaggacatggagggaatttgaaagggaagatattctcaatcggaaggaggaaagt
gactccttcgttgcatag

DBGET integrated database retrieval system