KEGG   Saccharomyces cerevisiae (budding yeast): YLR342WHelp
Entry
YLR342W           CDS       T00005                                 

Gene name
FKS1, CND1, CWH53, ETG1, GSC1, PBR1
Definition
Fks1p (EC:2.4.1.34)
Orthology
K00706  
1,3-beta-glucan synthase [EC:2.4.1.34]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Starch and sucrose metabolism
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YLR342W (FKS1)
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR342W (FKS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.34  1,3-beta-glucan synthase
     YLR342W (FKS1)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Structural polysaccharide
   YLR342W (FKS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:809997..815627
Genome map
AA seq 1876 aa AA seqDB search
MNTDQQPYQGQTDYTQGPGNGQSQEQDYDQYGQPLYPSQADGYYDPNVAAGTEADMYGQQ
PPNESYDQDYTNGEYYGQPPNMAAQDGENFSDFSSYGPPGTPGYDSYGGQYTASQMSYGE
PNSSGTSTPIYGNYDPNAIAMALPNEPYPAWTADSQSPVSIEQIEDIFIDLTNRLGFQRD
SMRNMFDHFMVLLDSRSSRMSPDQALLSLHADYIGGDTANYKKWYFAAQLDMDDEIGFRN
MSLGKLSRKARKAKKKNKKAMEEANPEDTEETLNKIEGDNSLEAADFRWKAKMNQLSPLE
RVRHIALYLLCWGEANQVRFTAECLCFIYKCALDYLDSPLCQQRQEPMPEGDFLNRVITP
IYHFIRNQVYEIVDGRFVKRERDHNKIVGYDDLNQLFWYPEGIAKIVLEDGTKLIELPLE
ERYLRLGDVVWDDVFFKTYKETRTWLHLVTNFNRIWVMHISIFWMYFAYNSPTFYTHNYQ
QLVDNQPLAAYKWASCALGGTVASLIQIVATLCEWSFVPRKWAGAQHLSRRFWFLCIIFG
INLGPIIFVFAYDKDTVYSTAAHVVAAVMFFVAVATIIFFSIMPLGGLFTSYMKKSTRRY
VASQTFTAAFAPLHGLDRWMSYLVWVTVFAAKYSESYYFLVLSLRDPIRILSTTAMRCTG
EYWWGAVLCKVQPKIVLGLVIATDFILFFLDTYLWYIIVNTIFSVGKSFYLGISILTPWR
NIFTRLPKRIYSKILATTDMEIKYKPKVLISQVWNAIIISMYREHLLAIDHVQKLLYHQV
PSEIEGKRTLRAPTFFVSQDDNNFETEFFPRDSEAERRISFFAQSLSTPIPEPLPVDNMP
TFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAA
YEGNENEAEKEDALKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTISGFMNY
SRAIKLLYRVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENAEF
LLRAYPDLQIAYLDEEPPLTEGEEPRIYSALIDGHCEILDNGRRRPKFRVQLSGNPILGD
GKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEQVNPYAPGLRYE
EQTTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLSQIGGKLHYGHPDFIN
ATFMTTRGGVSKAQKGLHLNEDIYAGMNAMLRGGRIKHCEYYQCGKGRDLGFGTILNFTT
KIGAGMGEQMLSREYYYLGTQLPVDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLSS
LAHESIMCIYDRNKPKTDVLVPIGCYNFQPAVDWVRRYTLSIFIVFWIAFVPIVVQELIE
RGLWKATQRFFCHLLSLSPMFEVFAGQIYSSALLSDLAIGGARYISTGRGFATSRIPFSI
LYSRFAGSAIYMGARSMLMLLFGTVAHWQAPLLWFWASLSSLIFAPFVFNPHQFAWEDFF
LDYRDYIRWLSRGNNQYHRNSWIGYVRMSRARITGFKRKLVGDESEKAAGDASRAHRTNL
IMAEIIPCAIYAAGCFIAFTFINAQTGVKTTDDDRVNSVLRIIICTLAPIAVNLGVLFFC
MGMSCCSGPLFGMCCKKTGSVMAGIAHGVAVIVHIAFFIVMWVLESFNFVRMLIGVVTCI
QCQRLIFHCMTALMLTREFKNDHANTAFWTGKWYGKGMGYMAWTQPSRELTAKVIELSEF
AADFVLGHVILICQLPLIIIPKIDKFHSIMLFWLKPSRQIRPPIYSLKQTRLRKRMVKKY
CSLYFLVLAIFAGCIIGPAVASAKIHKHIGDSLDGVVHNLFQPINTTNNDTGSQMSTYQS
HYYTHTPSLKTWSTIK
NT seq 5631 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgatcaacaaccttatcagggccaaacggactatacccagggaccaggtaac
gggcaaagtcaggaacaagactatgaccaatatggccagcctttgtatccttcacaagct
gatggttactacgatccaaatgtcgctgctggtactgaagctgatatgtatggtcaacaa
ccaccaaacgagtcttacgaccaagactacacaaacggtgaatactatggtcaaccgcca
aatatggctgctcaagacggtgaaaacttctcggattttagcagttacggccctcctgga
acacctggatatgatagctatggtggtcagtataccgcttctcaaatgagttatggagaa
ccaaattcgtcgggtacctcgactccaatttacggtaattatgacccaaatgctatcgct
atggctttgccaaatgaaccttatcccgcttggactgctgactctcaatctcccgtttcg
atcgagcaaatcgaagatatctttattgatttgaccaacagactcgggttccaaagagac
tccatgagaaatatgtttgatcattttatggttctcttggactctaggtcctcgagaatg
tctcctgatcaagctttactatctttacatgccgactacattggtggcgatactgctaac
tataaaaaatggtattttgctgctcagttagatatggatgatgaaattggttttagaaat
atgagtcttggaaaactctcaaggaaggcaagaaaagctaagaagaaaaacaagaaagca
atggaagaggccaatcccgaagacactgaagaaactttaaacaaaattgaaggcgacaac
tccctagaggctgctgattttagatggaaggccaagatgaaccagttgtctcccctggaa
agagttcgtcatatcgccttatatctgttatgttggggtgaagctaatcaagtcagattc
actgctgaatgtttatgttttatctacaagtgtgctcttgactacttggattcccctctt
tgccaacaacgccaagaacctatgccagaaggtgatttcttgaatagagtcattacgcca
atttatcatttcatcagaaatcaagtttatgaaattgttgatggtcgttttgtcaagcgt
gaaagagatcataacaaaattgtcggttatgatgatttaaaccaattgttctggtatcca
gaaggtattgcaaagattgttcttgaagatggaacaaaattgatagaactcccattggaa
gaacgttatttaagattaggcgatgtcgtctgggatgatgtattcttcaaaacatataaa
gagacccgtacttggttacatttggtcaccaacttcaaccgtatttgggttatgcatatc
tccattttttggatgtactttgcatataattcaccaacattttacactcataactatcaa
caattggtcgacaaccaacctttggctgcttacaagtgggcatcttgcgcattaggtggt
actgtcgcaagtttgattcaaattgtcgctactttgtgtgaatggtcattcgttccaaga
aaatgggctggtgctcaacatctatctcgtagattctggtttttatgcatcatctttggt
attaatttgggtcctattatttttgtttttgcttacgacaaagatacagtctactccact
gctgcacacgttgttgctgctgttatgttctttgttgcggttgctaccatcatattcttc
tccattatgccattgggggggttgtttacgtcatatatgaaaaaatctacaaggcgttat
gttgcatctcaaacattcactgctgcatttgcccctctacatgggttagatagatggatg
tcctatttagtttgggttactgtttttgctgccaaatattcagaatcgtactacttttta
gttttatctttgagagatccaattagaattttgtccaccactgcaatgaggtgtacaggt
gaatactggtggggtgcggtactttgtaaagtgcaacccaagattgtcttaggtttggtt
atcgctaccgacttcattcttttcttcttggatacctacttatggtacattattgtgaat
accattttctctgttgggaaatctttctatttaggtatttctatcttaacaccatggaga
aatatcttcacaagattgccaaaaagaatatactccaagattttggctactactgatatg
gaaattaaatacaaaccaaaggttttgatttctcaagtatggaatgccatcattatttca
atgtacagagaacatctcttagccatcgaccatgtacaaaaattactatatcatcaagtt
ccatctgaaatcgaaggtaaaagaactttgagagctcctaccttctttgtttctcaagat
gacaataattttgagactgaatttttccctagggattcagaggctgagcgtcgtatttct
ttctttgctcaatctttgtctactccaattcccgaaccacttccagttgataacatgcca
acgttcacagtattgactcctcactacgcggaaagaattctgctgtcattaagagaaatt
attcgtgaagatgaccaattttctagagttactcttttagaatatctaaaacaattacat
cccgttgaatgggaatgttttgttaaggatactaagattttggctgaagaaaccgctgcc
tatgaaggaaatgaaaatgaagctgaaaaggaagatgctttgaaatctcaaatcgatgat
ttgccattttattgtattggttttaaatctgctgctccagaatatacacttcgtacgaga
atttgggcttctttgaggtcgcagactctatatcgtaccatttcagggttcatgaattat
tcaagagctatcaaattactgtatcgtgtggaaaatcctgaaattgttcaaatgtttggt
ggtaatgctgaaggcttagaaagagagctagaaaagatggcaagaagaaagtttaaattt
ttggtctctatgcagagattggctaaattcaaaccacatgaactggaaaatgctgagttt
ttgttgagagcttacccagacttacaaattgcctacttggatgaagagccacctttgact
gaaggtgaggagccaagaatctattccgctttgattgatggacattgtgaaattctagat
aatggtcgtagacgtcccaagtttagagttcaattatctggtaacccaattcttggtgac
ggtaaatctgataaccaaaaccatgctttgattttttacagaggtgaatacattcaatta
attgatgccaaccaagataactacttggaagaatgtctgaagattagatctgtattggct
gaatttgaggaattgaacgttgaacaagttaatccatatgctcccggtttaaggtatgag
gagcaaacaactaatcatcctgttgctattgttggtgccagagaatacattttctctgaa
aactctggtgtgctgggtgatgtggccgctggtaaagaacaaacttttggtacattattt
gcgcgtactttatctcaaattggtggtaaattgcattatggtcatccggatttcattaat
gctacgtttatgaccactagaggtggtgtttccaaagcacaaaagggtttgcatttaaac
gaagatatttatgctggtatgaatgctatgcttcgtggtggtcgtatcaagcattgtgag
tattatcaatgtggtaaaggtagagatttgggtttcggtacaattctaaatttcactact
aagattggtgctggtatgggtgaacaaatgttatctcgtgaatattattatctgggtacc
caattaccagtggaccgtttcctaacattctattatgcccatcctggtttccatttgaac
aacttgttcattcaattatctttgcaaatgtttatgttgactttggtgaatttatcttcc
ttggcccatgaatctattatgtgtatttacgataggaacaaaccaaaaacagatgttttg
gttccaattgggtgttacaacttccaacctgcggttgattgggtgagacgttatacattg
tctattttcattgttttctggattgccttcgttcctattgttgttcaagaactaattgaa
cgtggtctatggaaagccacccaaagatttttctgccacctattatcattatcccctatg
ttcgaagtgtttgcgggccaaatctactcttctgcgttattaagtgatttagcaattggt
ggtgctcgttatatatccaccggtcgtggttttgcaacttctcgtataccattttcaatt
ttgtattcaagatttgcaggatctgctatctacatgggtgcaagatcaatgttaatgttg
ctgttcggtactgtcgcacattggcaagctccactactgtggttttgggcctctctatct
tcattaatttttgcgcctttcgttttcaatccacatcagtttgcttgggaagatttcttt
ttggattacagggattatatcagatggttatcaagaggtaataatcaatatcatagaaac
tcgtggattggttacgtgaggatgtctagggcacgtattactgggtttaaacgtaaactg
gttggcgatgaatctgagaaagctgctggtgacgcaagcagggctcatagaaccaatttg
atcatggctgaaatcataccctgtgcaatttatgcagctggttgttttattgccttcacg
tttattaatgctcaaaccggtgtcaagactactgatgatgatagggtgaattctgtttta
cgtatcatcatttgtaccttggcgccaatcgccgttaacctcggtgttctattcttctgt
atgggtatgtcatgctgctctggtcccttatttggtatgtgttgtaagaagacaggttct
gtaatggctggaattgcccacggtgttgctgttattgtccacattgcctttttcattgtc
atgtgggttttggagagcttcaactttgttagaatgttaatcggagtcgttacttgtatc
caatgtcaaagactcatttttcattgcatgacagcgttaatgttgactcgtgaatttaaa
aacgatcatgccaatacagccttctggactggtaagtggtatggtaaaggtatgggttac
atggcttggacccagccaagtagagaattaaccgccaaggtaattgagctttcagaattt
gcagctgattttgttctaggtcatgtgattttaatctgtcaactgccactcattataatc
ccaaaaatagataaattccactcgattatgctattctggctaaagccctctcgtcaaatt
cgtcccccaatttactctctgaagcaaactcgtttgcgtaagcgtatggtcaagaagtac
tgctctttgtactttttagtattggctatttttgcaggatgcattattggtcctgctgta
gcctctgctaagatccacaaacacattggagattcattggatggcgttgttcacaatcta
ttccaaccaataaatacaaccaataatgacactggttcccaaatgtcaacttatcaaagt
cactactatactcatacgccatcattaaagacctggtcaactataaaataa

DBGET integrated database retrieval system