KEGG   Saccharomyces cerevisiae (budding yeast): YMR306WHelp
Entry
YMR306W           CDS       T00005                                 

Gene name
FKS3
Definition
Fks3p (EC:2.4.1.34)
Orthology
K00706  
1,3-beta-glucan synthase [EC:2.4.1.34]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YMR306W (FKS3)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.34  1,3-beta-glucan synthase
     YMR306W (FKS3)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Structural polysaccharide
   YMR306W (FKS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:881159..886516
Genome map
AA seq 1785 aa AA seqDB search
MDFMSPKFSLTDVEYPAWCQDDEVPITMQEIREIFVELMDKFGFQKSSMENMYQHLMGQL
DSRASRTGAQNALVSLHVSYIGGEHANYRKWYFAAQLDLDEEIGFQNMRLHGKARQRNVK
MAKKRGVSIKEQIKQWNEKEQEFINNHPKITLTQEQLEDQTNLKSADYKWKLKMKKLTPE
NMIRQLALYLLCWGEANQVRFAPECLCFIFKCALDYDISTSSSEKTVKSPEYSYLNDVIT
PLYEFLRGQVYKKDAKGNWKRREKDHKNIIGYDDINQLFWYPEGFERIILNNGERLVDKP
LEERYLYFKDVAWSKVFYKTYRETRSWKHCFTNFNRFWIIHFAPFWFFTTFNSPTLYTKN
YIQLLNNQPTPQVRLSVIAFGGTIACLVQILATVFEWGFVPREWPGAQHLSSRMIGLLFC
LAINLGPSVYVLGFFEWDVHSKSAYIVSIVQLIIAFLTTFFFAVRPLGGLFRPYLNKDKK
HRRYISSQTFTASFPKLTGRSKWFSYGLWVFVYLAKYIESYFFLTLSLRDPIRVLSIMDL
SRCQGEYLLGPILCKWQAKITLVLMLLSDLGLFFLDTYLWYIICNCIFSIVLSFSLGTSI
LTPWKNVYSRLPKRIYSKILATSEMDVKFKAKILISQVWNAIVISMYREHLLSIEHLQRL
LFQQVDSLMGDTRTLKSPTFFVAQDDSTFKSMEFFPSNSEAKRRISFFAQSLATPISEPV
PVDCMPTFTVLVPHYSEKILLGLKEIIREESPKSKITVLEYLKHLHPTEWECFVKDTKLL
SMEKSFLKEAESSHDEDRLEIPDALYDPRSSPLSDHTESRKLPTEDDLIKEKINDLPFSY
FGFNSSEPSYTLRTRIWASLRTQTLYRTLSGFMNYSKAIKLLYRIENPSLVSLYRGNNEA
LENDLENMASRKFRMVVAMQRYAKFNKDEVEATELLLRAYPNMFISYLLEELEQNESEKT
YYSCLTNGYAEFDEESGLRKPIFKIRLSGNPILGDGKSDNQNHSIIFYRGEYIQVIDANQ
DNYLEECLKIRSVLSEFEELELNPTIPYIPGIEYEEEPPPIAIVGSREYIFSENIGVLGD
IAAGKEQTFGTLFARTLAEIGGKLHYGHPDFLNGIFMTTRGGLSKAQRGLHLNEDIYAGM
NAICRGGKIKHSDYYQCGKGRDLGFGSILNFTTKIGAGMGEQLLSREYYYLGTQLPMDRF
LSFFYAHPGFHLNNLFISFSVQLFFVLLLNLGALNHEIIACFYDKDAPITNLETPVGCYN
IQPALHWVSIFVLSIFIVFFIAFAPLLIQEVLEKGIWRAASRFLHHLLSMAPLFEVFVCQ
VYSNSLLMDLTFGGAKYISTGRGFAITRLDFFTLYSRFVNISIYSGFQVFFMLLFAIISM
WQPALLWFWITVISMCFAPFIFNPHQFAFMDFFIDYKTFIHWLFSGNTKYQKESWANFVK
SSRSRFTGYKSKTVDDISEDSGHDSKKARFWNVFFAELFLPFCVFLFNFTAFSFINAQTG
VSDSTPTSAVFRLLLVTFLPIFLNSIVLFLLFWVSLFVVPGLSYCCKDAGAVIAFIAHTF
SVLVYLLDFELMWFLQGWNFTRTLILLITCINMHLILFKVFTTIFLTREYKNNKAHLAWW
NGKWYNTGMGWSIILQPIREYFVKIMESSYFAADFFLGHFLLFIQTPIILLPFIDYWHTM
VLFWMNPRSIIAHKRILTRKQRALRSRIVSKYFSLYFVMLGVLLFMLIAPFFAGDFVSSP
QELLEGTLFEGIFQPNNQNNNDTGPNAPSTILTTTPTLPTFRTVA
NT seq 5358 nt NT seq  +upstreamnt  +downstreamnt
atggattttatgagtcccaagttttcgctaactgacgttgagtatcctgcttggtgccaa
gacgatgaagtcccaataacaatgcaggaaattagagaaatttttgtggagctcatggat
aagtttggcttccagaaatcttctatggaaaatatgtatcaacatttaatgggacagctg
gactccagggcaagtcgtacaggtgctcaaaatgctttagtatcgctacatgtttcatat
attggaggcgaacacgcaaattatagaaaatggtattttgccgctcagctcgatttagat
gaagagatcgggtttcaaaacatgcgactacatggaaaggcacgccaaagaaacgtaaaa
atggcgaagaaaagaggcgtatcgataaaggaacaaattaagcaatggaatgagaaggag
caagagttcatcaataaccatccaaagatcacactgactcaagaacaattggaagatcag
acaaacttgaaaagtgcagactacaaatggaaattgaaaatgaaaaaattgacgcccgaa
aatatgataagacagctggccctttatttgctttgctggggtgaagccaatcaagtcaga
ttcgccccagaatgcctttgctttattttcaaatgtgcacttgattatgatattagtacg
tcaagtagcgaaaaaacggtgaaatcacctgagtattcatacttaaatgacgttattact
cccttatacgaattcctaaggggccaagtatacaaaaaagacgcaaaggggaactggaaa
cgaagagaaaaagaccacaagaatattattggttacgacgacatcaatcaattattttgg
tacccggaaggatttgaacgtattattttaaacaatggagaacgattagttgacaagcca
ttggaggagagatatctttactttaaagacgttgcatggtctaaagtattttataagaca
tatagagaaaccagaagttggaagcattgttttaccaatttcaatagattctggattatc
cattttgcaccgttttggttcttcaccacatttaattcccccactttgtacaccaagaat
tatatacagttattgaataaccagcctacaccccaagttagactatcagtgattgccttt
ggaggcacaattgcatgtttagttcaaattttagccaccgtgttcgagtggggatttgta
cctcgagaatggccaggcgctcagcatttatcgagtagaatgattggcttacttttttgt
cttgcaatcaatttgggaccttccgtgtatgttctggggtttttcgaatgggatgttcat
tcaaaatctgcgtatatcgtgtccatcgtccaactaatcattgcatttttaaccactttt
ttttttgctgtcagacctttgggcggcttatttcgtccatatttgaataaagacaaaaaa
catcggaggtacatctcatcgcaaacctttaccgcttcatttcctaagctgacaggacgc
agcaaatggttttcttatgggttatgggtatttgtgtatttggcgaaatatattgagtcc
tatttttttttgaccttgtccctcagggaccccatcagggtcctctctattatggatttg
tccagatgtcaaggtgaatatttgttgggtcctattctatgtaaatggcaagccaaaatt
acattagttctcatgctgctttctgacttgggcctgttttttctcgacacttacctttgg
tacattatttgcaactgtattttttccattgtactgtcattttctcttggtacttcaatt
ctcacgccatggaagaatgtatactctcgattgccaaaaaggatatattccaaaatcctt
gctacttcagagatggatgtaaaatttaaagcaaaaatactgatatcgcaggtttggaat
gccattgttatatcaatgtatagggaacatcttctctccattgaacatttacaaagactc
ttgtttcagcaagttgactccttaatgggagacacaagaaccctgaaatcgcctacattt
ttcgttgcacaagatgattcaacgttcaagtcaatggaattttttccatcaaattcagag
gcaaaaagaaggatatccttttttgcccaatccctggcgacccccatttcagaacctgtt
ccagtggattgtatgccaacttttaccgttttggtaccccattattcagaaaagattctg
ttgggcttgaaggaaattatcagggaagaatctcctaaaagtaaaatcacggtgcttgag
tatttgaagcatctacaccctacagaatgggaatgttttgttaaggataccaaactacta
agcatggaaaagagctttttgaaagaggcagagagcagtcatgatgaagatagattggaa
attccggatgctctgtacgatccaaggtctagcccgctttctgaccatactgagtcccgg
aagttgcccacagaagacgatcttattaaggagaaaattaatgatttgccattttcttac
tttggcttcaactcatcagaaccatcgtacaccctgagaacaagaatctgggcatcattg
cggacgcagactttgtaccgaaccctttcagggtttatgaactattccaaagctattaag
ctactgtatcgaattgaaaacccctctttagttagcttgtatcgtggcaataatgaagca
ttggagaatgacttagaaaatatggctagcaggaaatttaggatggttgttgctatgcag
agatatgcaaaatttaataaggatgaagtggaggcaacagaactacttttaagagcctat
ccaaatatgtttatatcttaccttttggaagaattagagcaaaatgaatctgagaaaacg
tactattcgtgcctgactaatggctatgctgagtttgacgaagaaagtggattaaggaag
ccaatattcaaaattcgcctgtcgggcaatccaatacttggcgatggaaaatcggataat
cagaaccattctattatattttatcgtggtgagtatattcaggtgattgatgcaaaccaa
gataattatttggaggaatgcctaaagatacggtctgttttaagtgagttcgaagagctt
gagcttaatcccacaatcccatacattcctggcattgaatatgaagaagaaccaccgccc
atcgctattgttggttcaagagagtatattttttcagaaaatattggagtgttaggtgat
attgctgcaggtaaagaacagacttttggaaccttatttgctagaacgttggctgaaatt
ggtggtaaattgcactatgggcatcccgattttctcaatggcatttttatgaccactcgt
ggtggcctgtctaaggcacaaagaggattgcatttaaacgaggatatatatgctggaatg
aacgcaatctgccgtggtggaaagataaaacatagtgattactaccaatgtggtaagggt
agagatttgggatttgggtccatcctgaatttcactactaaaataggtgcaggtatgggg
gaacagctactatcaagggagtactattatttggggacacaacttcccatggatagattt
ttatcgtttttttatgcacatcctggtttccatctgaataatctttttatttccttttcg
gttcaactgttcttcgttctgcttttaaacttgggtgcgttgaaccatgaaattatagcc
tgcttttacgacaaggatgcaccaattacaaatcttgagacacccgttggttgttataat
attcagcctgcattgcattgggtatcgatattcgtactatcaatcttcattgttttcttt
attgcctttgcccctttgctgattcaagaagttttggaaaagggtatttggagagcagct
tcaaggttcctacatcatcttctttcaatggccccattatttgaagtattcgtctgccaa
gtttattcgaattctctattgatggacttgacctttgggggagcaaagtacatatctaca
ggtcgtgggtttgcaataacacgcctcgatttttttacgctctattccagatttgttaat
atatcgatatattctggtttccaagtgttcttcatgttattattcgcgattatttccatg
tggcaacccgccttattatggttttggattacagtcatttcgatgtgcttcgcacctttt
attttcaatccacatcagttcgcattcatggatttcttcattgattataaaacctttatc
cactggttattctcaggtaacacgaaatatcaaaaagaatcgtgggcaaactttgtcaag
agttctcgatcaagatttacgggctataaaagtaaaactgtagatgatatttccgaagat
tcaggccatgattcaaagaaagcgaggttttggaacgtcttctttgcagaactatttcta
cctttctgtgtgttcctcttcaacttcaccgctttttctttcattaatgcacaaacaggg
gtctctgactcaacaccaactagcgctgttttccgtttgttgctcgtaacttttttgcca
atctttcttaactcaatagtgctttttctattattttgggtttcactttttgtggttcct
ggattgtcatattgttgtaaagacgcaggtgccgtgattgcgtttattgcacacactttc
tcggttttggtctatcttttagatttcgaactgatgtggttcttacaaggttggaacttt
acccgtacattgatactgcttattacgtgcatcaatatgcatctgattcttttcaaggtc
tttacgacgatattcttgacaagggagtataaaaacaataaggcacatttggcatggtgg
aatggtaaatggtacaatacgggcatgggctggtctatcattttacagcccatacgagaa
tacttcgtgaagattatggaatctagttattttgcagcagatttctttcttggtcacttc
ctcttatttatacaaacgcccataatattgttaccatttatcgattactggcatacaatg
gtgctattttggatgaatccaagaagtattatcgcgcataaaagaattttgactcgaaag
cagagagcattaagaagtaggatagtttcaaaatatttctctctatattttgtgatgcta
ggtgtgctcctttttatgctcatcgcgccattctttgctggtgatttcgtatctagtccg
caagaattgctggaaggcacccttttcgaaggaatcttccaacctaacaaccaaaacaac
aacgatactggtccaaatgctccatcgacaatcctgactacaacaccaactttacctacc
tttaggactgtcgcatag

DBGET integrated database retrieval system