KEGG   Saccharomyces cerevisiae (budding yeast): YDR245WHelp
Entry
YDR245W           CDS       T00005                                 

Gene name
MNN10, BED1, REC41, SLC2
Definition
Mnn10p (EC:2.4.1.-)
Orthology
K05531  
mannan polymerase II complex MNN10 subunit [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Various types of N-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    YDR245W (MNN10)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YDR245W (MNN10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:952800..953981
Genome map
AA seq 393 aa AA seqDB search
MSSVPYNSQLPISNHLEYDEDEKKSRGSKLGLKYKMIYWRKTLCSSLARWRKLILLISLA
LFLFIWISDSTISRNPSTTSFQGQNSNDNKLSNTGSSINSKRYVPPYSKRSRWSFWNQDP
RIVIILAANEGGGVLRWKNEQEWAIEGISIENKKAYAKRHGYALTIKDLTTSKRYSHEYR
EGWQKVDILRQTFREFPNAEWFWWLDLDTMIMEPSKSLEEHIFDRLETLADRELKSFNPL
NLRDDIPYVDYSEEMEFLITQDCGGFNLGSFLIKNSEWSKLLLDMWWDPVLYEQKHMVWE
HREQDALEALYENEPWIRSRIGFLPLRTINAFPPGACSEYSGDSRYFYSEKDHDFVVNMA
GCNFGRDCWGEMQYYTTLMEKLNRKWYTRFFFP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtgtaccttataattcccaacttcctatatccaaccatctagagtacgatgaa
gatgaaaagaagagcagaggctcaaaactaggcctgaaatataaaatgatatactggagg
aaaactttatgcagttcgctagcgagatggagaaagctaatactattaatatctttagct
ttgtttttattcatatggataagcgattccaccataagcagaaatccatctaccacaagt
tttcaaggccaaaatagtaacgataataagttgagtaatactggttctagcatcaactcc
aaaagatatgtaccaccatattctaagagatcaagatggtcgttttggaatcaagatcct
aggattgtcattatattagcggcaaacgaaggtggtggtgtattgaggtggaaaaatgag
caagaatgggctatcgaaggcatatcaatagaaaataagaaggcctatgcgaagagacat
ggatatgcgttgactatcaaggatttgacaacgtccaaaagatactctcacgaatacaga
gagggttggcaaaaagtagatatattgagacagacgttcagggagtttcctaatgcagaa
tggttctggtggttggacctggatactatgataatggagccttctaaatcattagaagaa
catattttcgacagattggaaactctggctgacagagaattgaaaagttttaatccccta
aacctaagagacgacataccctatgtcgattattcagaggaaatggagtttctaataaca
caagattgtggaggcttcaatttgggctcatttctgataaaaaatagcgaatggtctaag
ctgcttctagatatgtggtgggaccccgttctgtatgaacaaaaacatatggtttgggaa
catagagaacaagatgcgttagaggcattatatgaaaacgaaccgtggattcgttcgaga
ataggatttttgcccttaagaacgatcaatgcattcccaccgggagcatgctctgaatac
agtggtgactcaagatacttttacagtgagaaagaccatgattttgttgtgaatatggcc
ggatgcaattttggcagagattgctggggcgagatgcagtactacaccactttaatggaa
aaactgaataggaaatggtacacgagatttttcttcccataa

DBGET integrated database retrieval system