KEGG   Saccharomyces cerevisiae (budding yeast): YJL186WHelp
Entry
YJL186W           CDS       T00005                                 

Gene name
MNN5
Definition
Mnn5p (EC:2.4.1.-)
Orthology
K05536  
alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Various types of N-glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Various types of N-glycan biosynthesis [PATH:sce00513]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:80155..81915
Genome map
AA seq 586 aa AA seqDB search
MLIRLKKRKILQVIVSAVVLILFFCSVHNDVSSSWLYGKKLRLPVLTRSNLKNNFYTTLV
QAIVENKPADSSPDLSKLHGAEGCSFANNVAAHDSGHDSDLSYESLSKCYNLNKTVQESL
REVHSKFTDTLSGKLNFSIPQREALFSGSEGIVTIGGGKYSVLAYTMIKKLRDTGTTLPI
EVIIPPQDEGEDDFCKNWLPKFNGKCIYFSDIVPSKPLSDLKLTHFQLKVFGLIISSFKR
IIFLDADNYAVKNLDLAFNTTSFNDTGLILWPDFWRRVTPPAFYNIIGSSINIGKRVRFV
SDDISPVSRYDPFVSNSNDYTPKERQEHFLKHVPLHDLDGTMPDLSSESGQMVIDKIRHF
NTLLLALYYNVYGPTWYYKMISQGTAGEGDKDTFVAAAHALNMPYYQVRTNFEFDGFFYQ
KDDYKGLALLQHDFEQDYKQYQKAQQKVKANIEEFSKLDPDYTLDNGFLKTLMVNDDGSD
LDIMFIHASFYKADPWTLYHENRFIGPNGEQVRGFRKPHRYGMDFELFLFNDMRGSFCTT
PKSQVIKFKYFTDKVNTPEWDAMCEYLTNHVNYLESTHKEAMGEKN
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctgattaggttaaagaagagaaaaatcctgcaggtcatcgtgagcgcagtagtgcta
attttatttttttgttctgtgcataatgatgtgtcttctagttggttatacggtaaaaag
cttagattgccggttctaacaaggtcgaaccttaaaaacaatttttacacaacactggta
caagccatcgtggaaaacaagccggcagattcgtctccggacttgagtaagttgcatggg
gcggaagggtgtagctttgcaaataacgttgctgcacacgactctggacacgatagtgac
ttaagttacgagagcttgagtaaatgctataatttgaataaaacagtacaagaaagccta
cgagaagtgcacagtaagtttacagacaccttatcagggaaactgaatttttccatccca
caaagagaggcacttttctcaggttctgagggcattgtcaccattggaggtggaaagtat
tctgtgctcgcgtatacgatgatcaaaaagttgagggacacgggtactacattgcctatt
gaagtcatcattccgcctcaggacgaaggcgaggatgatttttgtaagaactggttgccg
aaattcaatggtaagtgcatttatttctcagatatcgttccttcaaagccattaagcgat
ttaaaactcacgcacttccagttgaaagtctttgggttgataatttccagtttcaagcgt
attatcttcttggacgcagataactatgcggtgaaaaaccttgaccttgcttttaacact
acatccttcaacgatactggcctgatattgtggcccgatttttggagacgtgtcacccct
cccgccttttacaacattataggatctagcattaacatcggcaaaagagtccgttttgtt
agtgacgatatttcccccgtgtcacgttatgatccatttgttagtaactcaaacgattac
actccaaaggagagacaggagcatttcctgaaacatgttcccttacatgatctggacggc
acgatgccagacttgagctctgaatcaggccagatggtgattgataagattcgccatttc
aacactctattactggcgctatactataatgtttatgggcctacctggtattataagatg
atttctcaaggcactgccggtgaaggtgacaaagacactttcgtcgctgctgcccatgcc
ttgaatatgccatactatcaagtgaggactaactttgaatttgatggtttcttctatcaa
aaagatgattacaagggtctcgccttgctccagcatgattttgaacaagattacaagcaa
taccaaaaggcgcagcagaaagttaaagccaacattgaggaattttccaaactggatcca
gattatactttggacaatggtttcttgaaaactttgatggttaatgatgacggttctgat
ttggatatcatgttcattcatgccagtttctacaaggcagatccatggactctttatcat
gaaaacagatttatcggtccaaatggcgaacaagtacggggcttcaggaagccgcatcgc
tatggaatggattttgaattgtttttattcaatgatatgagggggtccttctgtaccact
ccgaaaagccaagttattaaattcaagtattttaccgataaagttaataccccagaatgg
gatgcaatgtgtgagtatttgaccaatcatgttaattatctggagagcacacacaaagaa
gctatgggggagaaaaactaa

DBGET integrated database retrieval system