KEGG   Saccharomyces cerevisiae (budding yeast): YPL050CHelp
Entry
YPL050C           CDS       T00005                                 

Gene name
MNN9
Definition
Mnn9p
Orthology
K05529  
mannan polymerase complexes MNN9 subunit [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Various types of N-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    YPL050C (MNN9)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YPL050C (MNN9)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YPL050C (MNN9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XVI:complement(460779..461966)
Genome map
AA seq 395 aa AA seqDB search
MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLGLNGQSISQHKWAHEKENTF
YFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHYDLNKLHSTSEAAVNKEHILIL
TPMQTFHQQYWDNLLQLNYPRELIELGFITPRTATGDLALKKLENAIKKVQTDKKTQRFS
KITILRQNSQSFDKLMEKERHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADII
ETPPSLIQDMTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDD
EIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFY
HLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcactttctcttgtatcgtaccgcctaagaaagaacccgtgggttaacatttttcta
cctgttttggccatatttctaatatatataatttttttccagagagatcaatctctgttg
ggacttaatggccagtccatttcccaacacaaatgggcacacgaaaaggaaaacacattt
tattttcccttcaccaagaaatacaaaatgccaaagtactcttataagaaaaaaagcggc
tggttgttcaacgatcacgtggaagatattatcccagaaggtcatattgcacattatgat
ttgaacaaattgcactctacgtcagaagcagctgtcaataaggagcatattttgatattg
actccaatgcaaacatttcatcaacaatactgggacaatttgctgcagctaaattaccct
cgggaattgattgaattggggttcattacaccaagaacagccactggtgacttggcctta
aagaaattggagaatgctattaaaaaggttcaaacggacaagaaaactcaaagatttagt
aaaattactattttgcgacagaattcccagagttttgataagttgatggagaaggaaaga
cacgctttagatgttcaaaaggaaagacgtgcagcaatggctttggcgcgcaatgaatta
ctattctccaccataggacctcacacttcttgggtgctgtggctagatgccgatattata
gagacaccaccatctttaattcaagacatgaccaaacacaacaaagctatcttagctgca
aacatttatcaaagattttacgatgaagagaagaagcaaccatcaatcagaccatacgat
ttcaacaactggcaagaaagtgacaccggtttagaaatagcctctcagatgggtgatgac
gagattattgtcgagggttatgcagaaattgccacttataggccattaatggctcatttc
tacgatgctaatggcgtaccaggtgaagagatggcgctggatggtgttggtggaggctgt
actttggtcaaagcagaagttcacagagacggtgccatgttccctaatttcccattttat
cacttgattgaaacagaaggttttgctaagatggcgaagagattaaactacgatgtattt
ggcttaccaaactatttggtttatcacatagaggaagagaaccattga

DBGET integrated database retrieval system