KEGG   Saccharomyces cerevisiae (budding yeast): YJR131WHelp
Entry
YJR131W           CDS       T00005                                 

Gene name
MNS1
Definition
mannosyl-oligosaccharide 1,2-alpha-mannosidase (EC:3.2.1.113)
Orthology
K01230  
mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
N-Glycan biosynthesis
Various types of N-glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YJR131W (MNS1)
   00513 Various types of N-glycan biosynthesis
    YJR131W (MNS1)
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YJR131W (MNS1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     YJR131W (MNS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:667644..669293
Genome map
AA seq 549 aa AA seqDB search
MKNSVGISIATIVAIIAAIYYVPWYEHFERKSPGAGEMRDRIESMFLESWRDYSKHGWGY
DVYGPIEHTSHNMPRGNQPLGWIIVDSVDTLMLMYNSSTLYKSEFEAEIQRSEHWINDVL
DFDIDAEVNVFETTIRMLGGLLSAYHLSDVLEVGNKTVYLNKAIDLGDRLALAFLSTQTG
IPYSSINLHSGQAVKNHADGGASSTAEFTTLQMEFKYLAYLTGNRTYWELVERVYEPLYK
NNDLLNTYDGLVPIYTFPDTGKFGASTIRFGSRGDSFYEYLLKQYLLTHETLYYDLYRKS
MEGMKKHLLAQSKPSSLWYIGEREQGLHGQLSPKMDHLVCFMGGLLASGSTEGLSIHEAR
RRPFFSLSLERKSDWDLAKGITDTCYQMYKQSSSGLAPEIVVFNDGNIKQDGWWRSSVGD
FFVKPLDRHNLQRPETVESIMFMYHLSHDHKYREWGAEIATSFFENTCVDCNDPKLRRFT
SLSDCITLPTKKSNNMESFWLAETLKYLYILFLDEFDLTKVVFNTEAHPFPVLDEEILKS
QSLTTGWSL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactctgtcggtatttcaattgcaaccattgttgctatcatagcagctatatac
tatgtgccatggtacgaacactttgagagaaagtcaccgggggccggagaaatgagagat
cggattgaaagcatgttcttggaatcgtggagagactattccaagcatggctggggatac
gatgtgtatggacctattgagcacacttcccataatatgcctcgtggcaaccagccgtta
ggctggattatcgtagattcagtggataccttgatgttaatgtataactcctccacacta
tacaaaagtgagttcgaggcagaaattcagagatcggagcattggataaacgatgttttg
gattttgatattgatgccgaagtgaatgtttttgaaactactattagaatgctaggtggt
ttattatccgcatatcatctatctgatgttttagaagtaggtaataagactgtctacttg
aacaaagcaatagatttgggggataggcttgctttggcgttcttatccactcagaccgga
attccatactcaagtataaaccttcatagtggccaagcggttaagaaccatgcagatggg
ggggcatcttctaccgcagaattcactacgctacaaatggaattcaaatatctggcgtat
ttgacaggaaatcgtacttattgggagctggtggagcgtgtttacgagccattatacaaa
aataacgatcttctaaatacctacgatggattggttccaatttatacatttccagatact
gggaagtttggtgcttcgactatccggttcggatcaagaggtgattctttttatgagtat
ttactaaaacaatatttattgacgcacgaaacactttattatgatctgtacagaaaatcc
atggaaggtatgaaaaagcatttattagcacaatccaaaccctcttctctgtggtacatt
ggggaaagagaacaaggtctacatggacaactttctcctaagatggaccacctcgtgtgc
tttatggggggattgttagcatcaggctctactgagggcctttctattcatgaagcccga
agacgtccgtttttctctctttcccttgaaagaaaaagtgactgggatttggctaaaggg
ataactgacacatgttatcaaatgtacaagcagtcttcctcggggcttgcgcctgaaatc
gttgtcttcaatgatggaaacataaaacaggatggttggtggcggtcgtctgtgggtgat
ttttttgttaaaccactcgataggcacaacctacaaagaccagaaacggtggaatcgatt
atgttcatgtatcatttatctcatgatcacaaatatcgtgaatggggggcggaaatcgca
actagcttctttgaaaatacctgtgttgattgtaatgacccaaaattaaggcggttcacc
agtttaagtgattgtatcacgttacctacaaagaaatctaacaatatggaaagtttctgg
ttggcagagactttaaagtatttatatatattgtttttagacgagtttgatttgaccaaa
gttgttttcaacacagaagctcatccttttccagtattagacgaagaaatattaaaatcg
cagtctctgaccacaggttggtcgttgtag

DBGET integrated database retrieval system