KEGG   Saccharomyces cerevisiae (budding yeast): YGL038CHelp
Entry
YGL038C           CDS       T00005                                 

Gene name
OCH1, LDB12, NGD29
Definition
Och1p (EC:2.4.1.232)
Orthology
K05528  
alpha 1,6-mannosyltransferase [EC:2.4.1.232]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Various types of N-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    YGL038C (OCH1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.232  initiation-specific alpha-1,6-mannosyltransferase
     YGL038C (OCH1)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YGL038C (OCH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(425362..426804)
Genome map
AA seq 480 aa AA seqDB search
MSRKLSHLIATRKSKTIVVTVLLIYSLLTFHLSNKRLLSQFYPSKDDFKQTLLPTTSHSQ
DINLKKQITVNKKKNQLHNLRDQLSFAFPYDSQAPIPQRVWQTWKVGADDKNFPSSFRTY
QKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFA
RGGIYSDMDTMLLKPIDSWPSQNKSWLNNIIDLNKPIPYKNSKPSLLSSDEISHQPGLVI
GIEADPDRDDWSEWYARRIQFCQWTIQAKPGHPILRELILNITATTLASVQNPGVPVSEM
IDPRFEEDYNVNYRHKRRHDETYKHSELKNNKNVDGSDIMNWTGPGIFSDIIFEYMNNVL
RYNSDILLINPNLNKNDEEGSESATTPAKDVDNDTLSKSTRKFYKKISESLQSSNSMPWE
FFSFLKEPVIVDDVMVLPITSFSPDVGQMGAQSSDDKMAFVKHMFSGSWKEDADKNAGHK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggaagttgtcccacctgatcgctacaaggaaatcaaaaacaatagtcgtaacc
gtacttcttatttattctttgttgacatttcacttgtcaaacaaaaggctgctttctcag
ttttaccctagcaaagatgatttcaagcaaactcttctccctacgacttctcattcacaa
gatataaatttgaagaaacaaattacagttaacaagaaaaaaaatcaattgcataattta
cgtgatcaattatcgtttgcgtttccctacgactctcaggcccccatcccgcaaagggtg
tggcagacctggaaagtcggcgcagatgataagaattttccctcttcgttcagaacctat
caaaaaacatggtctggttcgtattcaccggattaccaatattctctgatttcggatgat
tctattatcccttttttggagaatctttacgcacccgttccgatagtcatccaagcgttt
aaattgatgcctggaaatatcctaaaggcagattttttaaggtacctattattatttgca
agaggtggtatttactcagatatggatactatgcttttgaagccaattgattcatggcct
tctcagaataagtcatggctaaacaacataatagatttgaataaacctattccttataag
aactcaaagccctcacttctctcaagtgatgagatatcacaccagccaggtttggtcatc
ggcattgaggcagatccggacagagatgattggagtgaatggtatgctcgtaggatccag
ttttgtcaatggactatccaagccaaaccaggtcacccaattctaagagaattgatctta
aatattactgcaacgactttggcgagcgtacaaaacccaggagttcctgtcagtgaaatg
attgatccaagatttgaagaagactacaacgtaaactataggcacaaaagacgtcatgat
gagacctacaaacactccgaattgaaaaataacaaaaatgttgatggctcagatataatg
aattggacgggtccaggtattttctccgacattattttcgaatacatgaacaatgtgctc
cgatacaatagcgatatcttgttaatcaacccaaacctaaacaagaacgacgaagaaggt
agtgagagtgccaccacaccagcaaaagatgttgataacgatacgctgtccaaatcaaca
agaaaattttataagaaaatatcagagtctttgcaatcgtcaaattcaatgccctgggaa
ttcttctcttttttgaaagaaccagttatcgttgatgatgtgatggttctaccaataaca
agtttttcaccagatgtggggcagatgggcgcccagtctagtgacgacaaaatggctttt
gtaaagcacatgtttagcgggagctggaaagaagatgctgataaaaatgcaggtcataaa
taa

DBGET integrated database retrieval system