KEGG   Saccharomyces cerevisiae (budding yeast): YML115CHelp
Entry
YML115C           CDS       T00005                                 

Gene name
VAN1, LDB13, VRG7, VRG8
Definition
Van1p
Orthology
K05530  
mannan polymerase I complex VAN1 subunit [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Various types of N-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    YML115C (VAN1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YML115C (VAN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(40187..41794)
Genome map
AA seq 535 aa AA seqDB search
MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF
QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYY
DYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF
EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY
DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD
EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT
FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQSE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgttttttaatttaaggtcaaatataaagaagaaagccatggacaatggacta
agcctgcccatttcaaggaacggtagctcgaacaacatcaaggacaaacgctcagagcat
aactccaactcattaaagggcaaatacaggtaccagccgcgctccacaccgtctaaattc
cagcttacggtgagtatcacatctcttattattatcgccgttctgtcgttatatctcttt
atatcatttctctccggaatgggcattggtgtatccacgcaaaatggtaggtcgttgttg
ggttcctcaaaatcctccgaaaattacaagactatcgacctagaagatgaagaatattac
gactatgattttgaggatatcgatcctgaagtgatttcaaaatttgatgatggtgtgcaa
cattatctaatatcacaatttggttcagaagtgttgactcccaaggatgatgaaaaatac
caaagggaactcaacatgctttttgattccactgttgaggagtacgacctgtcgaatttt
gaaggtgctccgaatggattggaaacacgtgatcacattcttttatgcattccactaaga
aacgctgcggatgtattgccattaatgttcaagcatttaatgaacctaacctatccacac
gagctgattgatctggcctttttagtcagtgattgctcagaaggtgacactacgttggat
gctttaatagcgtattctaggcacttacaaaatggcacgttgtctcagatttttcaagag
attgacgctgtcattgattcgcaaacaaaaggcaccgataaattatatcttaaatatatg
gacgaaggttatatcaaccgtgtccaccaggcattttcaccaccattccatgaaaattat
gacaagccatttagatcagtacaaattttccaaaaggattttggccaagtaattggacaa
ggttttagtgacagacatgccgttaaggttcaaggtataagacgaaaactaatggggagg
gcaagaaattggttaactgccaatgctttgaaaccttaccactcatgggtttattggaga
gatgctgatgtagagctgtgccctggttcagtcattcaagatttgatgagcaaaaactac
gatgttatcgtccctaacgtttggagaccactacctacatttttgggaactgaacaacca
tatgatttgaattcttggatggaatctcaggaggcactagcattggcaaagactcttgac
gaagatgatgttattgtagaaggctatgcagaatatcctacgtggagagttcacttagcc
tatatcagagatgcagaaggtgatccaaatgaagcggtggacttggacggtgtaggggga
gtttctattttggcgaaggccaaaatatttagaaacggggtacagtttcctgcatttact
tttgaaaatcatgcagaaacagaagcatttggtaaaatggcaaagaaaatggggtacagg
gttggtggtttaccgcattatactatttggcatatttatgaaccgagcgatgacgatttg
aaggaaattgcgtcaagggaaagagagaagagaagacaatcagagtaa

DBGET integrated database retrieval system