KEGG   Saccharomyces cerevisiae (budding yeast): YPL053CHelp
Entry
YPL053C           CDS       T00005                                 

Gene name
KTR6, MNN6
Definition
Ktr6p (EC:2.4.1.-)
Orthology
K05537  
mannosylphosphate transferase [EC:2.7.8.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Various types of N-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    YPL053C (KTR6)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     YPL053C (KTR6)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YPL053C (KTR6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(457118..458458)
Genome map
AA seq 446 aa AA seqDB search
MHVLLSKKIARFLLISFVFVLALMVTINHPKTKQMSEQYVTPYLPKSLQPIAKISAEEQR
RIQSEQEEAELKQSLEGEAIRNATVNAIKEKIKSYGGNETTLGFMVPSYINHRGSPPKAC
FVSLITERDSMTQILQSIDEVQVKFNKNFAYPWVFISQGELDGMKQEMIRQAITDSMNGD
PELINIKFAEIPADEWVYPEWIDENKAAESLISLANVPDGDSRAVRYQARYFAGFFWRHP
VLDEFDWYWRVDPGIKLYCDIDHDLFRWMQDEGKVFGFTLSMSEAKEANEKIWDVTKKFA
KDFPKFISENNFKSFITKKDSEDFNNCEFTSNFEIGNLNFYRSPAYRKFFNYIDEEGGIF
YWKWSDSIIHTIGLSMLLPKDKIHFFENIGFHYDKYNNCPLNDDIWNQYNCNCDQGNDFT
FRSGSCGGHYFDIMKKDKPEGWDRLP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtactgctgagcaaaaaaatagcacgctttctgttgatttcgtttgttttcgtg
cttgcgctaatggtgacaataaatcatccaaaaacaaagcagatgtctgaacagtatgtt
acaccataccttccgaaatctttgcaacctattgcaaaaattagtgcagaggaacaaagg
cgtatacaaagtgaacaggaagaagccgaattgaagcaatctttagagggagaggccatt
agaaatgccaccgtgaatgccattaaggaaaagatcaaatcttatggtggtaatgaaacg
acgctagggttcatggtgccatcgtatatcaatcatagaggatcaccaccaaaggcgtgc
tttgtctcactaattactgaaagggattccatgacccaaatcttacaatctattgatgaa
gtgcaggtgaagtttaacaaaaattttgcttatccttgggtttttattagtcagggggag
cttgacggaatgaagcaagaaatgattcgtcaagccataactgattctatgaatggtgat
cctgagttaattaatattaaatttgctgaaattcctgcagacgaatgggtataccctgaa
tggattgatgaaaataaagcagcagaatcgctaatttcattagcaaatgtaccggatggt
gattctagagctgtaagatatcaagctagatattttgcagggtttttttggaggcatcca
gttctggatgagtttgattggtactggagagtagaccctggtattaaattgtactgtgat
attgatcatgacctttttaggtggatgcaagatgaaggcaaagtgtttggtttcacattg
agtatgagtgaagctaaggaagccaatgagaagatttgggatgttacgaaaaaatttgca
aaggattttccaaagtttatttccgagaataatttcaagtcatttattacaaaaaaggac
tctgaagattttaacaactgtgaattcacatcaaattttgaaattggtaatttgaacttt
tatagatcgccagcttacaggaaattttttaattacatcgacgaagagggcggtattttc
tactggaaatggtctgattccatcatccacacaattgggttatcgatgctgttgccaaag
gataaaatacattttttcgaaaatataggattccattatgacaagtacaataactgtccc
ctaaacgatgatatatggaaccaatataattgtaactgtgaccagggtaacgatttcacg
tttagaagtggttcatgtggcggacattacttcgacattatgaagaaagataagccagaa
ggttgggataggttaccataa

DBGET integrated database retrieval system