KEGG   Saccharomyces cerevisiae (budding yeast): YAL016WHelp
Entry
YAL016W           CDS       T00005                                 

Gene name
TPD3, FUN32
Definition
Tpd3p
Orthology
K03456  
serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
mRNA surveillance pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    YAL016W (TPD3)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YAL016W (TPD3)
   04113 Meiosis - yeast
    YAL016W (TPD3)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     YAL016W (TPD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
I:124879..126786
Genome map
AA seq 635 aa AA seqDB search
MSGARSTTAGAVPSAATTSTTSTTSNSKDSDSNESLYPLALLMDELKHDDIANRVEAMKK
LDTIALALGPERTRNELIPFLTEVAQDDEDEVFAVLAEQLGKFVPYIGGPQYATILLPVL
EILASAEETLVREKAVDSLNNVAQELSQEQLFSDFVPLIEHLATADWFSSKVSACGLFKS
VIVRIKDDSLRKNILALYLQLAQDDTPMVKRAVGKNLPILIDLLTQNLGLSTDEDWDYIS
NIFQKIINDNQDSVKFLAVDCLISILKFFNAKGDESHTQDLLNSAVKLIGDEAWRVRYMA
ADRFSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVREAVAKQVSGFAKFLNDPSIILNK
ILPAVQNLSMDESETVRSALASKITNIVLLLNKDQVINNFLPILLNMLRDEFPDVRLNII
ASLKVVNDVIGIELLSDSLLPAITELAKDVNWRVRMAIIEYIPILAEQLGMQFFDQQLSD
LCLSWLWDTVYSIREAAVNNLKRLTEIFGSDWCRDEIISRLLKFDLQLLENFVSRFTILS
ALTTLVPVVSLDVVTEQLLPFISHLADDGVPNIRFNVAKSYAVIVKVLIKDEAKYDALIK
NTILPSLQTLCQDEDVDVKYFAKKSLAECQELLKN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagcaagatcaacaacggcaggtgccgtgccctcggcagcaacaacatcaaca
acatcaacaacgtcaaactctaaggactcagactctaacgagtcattatatcccttggct
ctgcttatggatgagttaaaacatgatgatattgctaatagggtagaagccatgaaaaaa
ctagataccatcgcgttggcactcggtcccgaaagaacaagaaacgagttgattcccttt
ttaacggaagttgcacaagatgatgaagatgaggtgtttgccgttttagccgaacagtta
ggaaaatttgtcccctacattggcggtcctcaatacgccacaatcctattaccagttttg
gaaattttggcatctgcagaagaaactttggttagagaaaaggccgtagattctctgaat
aacgtggcccaagaactttctcaagaacaattatttagtgacttcgtccctttaattgaa
catttagctactgcagattggttttcttcaaaagtttctgcttgtggtcttttcaagtct
gttattgttagaatcaaagatgattcattgagaaagaatatcctggctttatacttacaa
ctcgctcaagatgatactccaatggtgaaaagggccgtcggtaaaaacctgcccatcttg
atcgatctgttgactcaaaatttgggattatctacagacgaagattgggattacatttct
aacattttccagaaaatcattaacgataatcaagattctgtcaagtttctggcagttgat
tgtttaatttccatcttgaaattttttaacgctaaaggtgatgagtctcacactcaagat
ttattgaactctgctgtcaaattaattggtgacgaagcgtggagggtacgttacatggct
gccgatagattttcagatttagcctcgcaattcagttccaaccaagcatatatcgatgaa
ttagtacaaccatttttgaacctttgtgaggacaacgagggagatgttagggaagctgtg
gctaaacaagtttctgggtttgccaagttcctaaatgatccttcaattatattgaataag
atcttacctgctgtgcagaatttgagtatggacgaaagtgaaacagtgagatctgctttg
gcttctaagattacaaatattgtattactgttgaataaagatcaagtcattaacaatttt
cttccgattttactgaatatgctaagagatgagttccctgacgttcgtttaaatatcatt
gccagcttgaaggttgtcaatgacgtaataggaattgagctgctatcagactctttgtta
cctgccataacagaattagccaaggacgtgaattggagagttagaatggctataattgag
tacatacctatcttggcagaacaattaggtatgcaattttttgaccaacagttaagcgat
ttatgtctttcatggttgtgggatactgtttattctatcagagaagccgcagtgaataat
ttaaaaaggttaacggaaatatttggctctgattggtgtcgtgatgaaattatttcaaga
ctgctcaaatttgatctacaattactggaaaattttgtctcgaggttcacaatactctct
gctctaaccactttggtgcccgtggtatcgttagatgtcgttactgagcaactattacca
ttcatttctcacttggctgatgacggtgttccaaatattaggtttaatgtggccaaatcc
tacgctgtgatagtgaaggttttaattaaggacgaggccaaatatgatgcattaattaag
aacacaattttaccctcattgcaaacgctgtgtcaagacgaagatgttgatgtaaaatac
ttcgctaagaaaagtttggcagaatgtcaagaacttttaaaaaattga

DBGET integrated database retrieval system