KEGG   Saccharomyces cerevisiae (budding yeast): YAL021CHelp
Entry
YAL021C           CDS       T00005                                 

Gene name
CCR4, FUN27, NUT21
Definition
(RefSeq) CCR4-NOT core exoribonuclease subunit CCR4
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YAL021C (CCR4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     YAL021C (CCR4)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     YAL021C (CCR4)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     YAL021C (CCR4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos LRR_8 LRR_4 LRR_1
Motif
Other DBs
NCBI-GeneID: 851212
NCBI-ProteinID: NP_009381
SGD: S000000019
UniProt: P31384
Structure
PDB: 

Jmol
Position
I:complement(110846..113359)
Genome map
AA seq 837 aa AA seqDB search
MNDPSLLGYPNVGPQQQQQQQQQQHAGLLGKGTPNALQQQLHMNQLTGIPPPGLMNNSDV
HTSSNNNSRQLLDQLANGNANMLNMNMDNNNNNNNNNNNNNNNGGGSGVMMNASTAAVNS
IGMVPTVGTPVNINVNASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQ
NAMKKYLATQQAQQAQQQAQQQAQQQVPGPFGPGPQAAPPALQPTDFQQSHIAEASKSLV
DCTKQALMEMADTLTDSKTAKKQQPTGDSTPSGTATNSAVSTPLTPKIELFANGKDEANQ
ALLQHKKLSQYSIDEDDDIENRMVMPKDSKYDDQLWHALDLSNLQIFNISANIFKYDFLT
RLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPW
EFGNLCNLQFLGVEGNPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHERRFIEINTDG
EPQREYDSLQQSTEHLATDLAKRTFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKL
KEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCC
IFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHIPSGDTIW
AVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEETSHNFRQDIKKFPVLICGDFNSYINS
AVYELINTGRVQIHQEGNGRDFGYMSEKNFSHNLALKSSYNCIGELPFTNFTPSFTDVID
YIWFSTHALRVRGLLGEVDPEYVSKFIGFPNDKFPSDHIPLLARFEFMKTNTGSKKV
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacccttctttactaggctaccctaatgtgggcccgcagcagcaacagcaacag
cagcaacagcagcatgccgggctactaggaaagggtacaccaaacgctctacagcagcag
ctacacatgaaccagctcaccgggatacctccaccgggactcatgaacaacagcgatgta
cacacttccagcaacaacaactcgcgccagttgctcgaccaattggctaatgggaacgcg
aacatgctcaatatgaacatggataacaacaataacaacaataacaacaacaacaacaac
aacaacaacggcggtggaagcggggtgatgatgaatgcctccacagccgcagtaaattct
atagggatggttcctaccgttggtacgcctgtgaacatcaatgtgaacgccagtaaccct
ttattacacccgcacttggatgacccttctttactaaacaatccgatctggaagcttcaa
ttgcatctggctgcagtgtccgcacaatctctggggcaacccaacatttatgctagacaa
aacgctatgaagaagtatttggctacacaacaggctcagcaagctcagcaacaagcgcag
caacaggcacagcagcaggtcccgggcccatttggccccggacctcaggctgcaccacca
gctttgcagcccaccgatttccagcaatctcacattgcagaagcctccaaatcactggta
gactgcacaaagcaagccttgatggaaatggccgacactctcaccgacagcaagacagca
aagaaacaacaacctacgggagatagcactccctcaggcacggcaactaacagtgcagtt
tctacaccattgactcccaagatagagctgtttgctaatggcaaggacgaagccaaccag
gcgctcttacaacacaagaaactgtctcagtacagcatcgacgaagatgacgacattgaa
aacagaatggtcatgcccaaggactcgaaatacgacgaccaattatggcacgcgctagat
ttgtccaacttgcaaatcttcaatatcagcgccaacatcttcaagtacgattttctaacg
agactatatttgaatggcaatagcctcacggaactgccagcggagatcaagaacctaagc
aacctacgcgttttggacctgtcgcataataggttaacatctctaccagcggaactaggc
tcatgtttccaattgaaatacttctacttttttgataacatggtcaccacattaccatgg
gagtttgggaacctgtgtaaccttcagtttcttggtgtagaaggaaaccccttagaaaaa
cagtttttaaagatccttacagaaaaatctgtcacgggattgattttctacctaagggac
aacagaccagagattcccttaccgcatgaacgtaggttcatcgaaatcaataccgatggg
gaaccacagagggagtacgattctttgcagcaatccactgagcatctggccaccgattta
gccaagaggacgttcaccgtcttatcctacaacaccttatgtcaacactatgccacccca
aaaatgtaccgttacacaccgtcgtgggcgttaagttgggattacaggcgcaataaatta
aaggagcagattctctcgtacgacagtgatctgttgtgtttacaagaagtggagtctaag
acttttgaagagtattgggtgcccctattggacaagcacggttatacaggcatcttccat
gcaaaggcaagagccaagaccatgcattccaaggactccaagaaagtggacgggtgttgc
atttttttcaaaagggaccaattcaagttgatcaccaaagacgccatggatttcagcggt
gcttggatgaaacacaagaagttccaaagaactgaagattatttaaaccgtgcaatgaac
aaagacaacgttgcactgttcttaaagctacaacacattcctagtggcgacaccatatgg
gcggtcaccacgcatttgcactgggatccaaaatttaatgatgtcaagacattccaagta
ggtgtcctgttagatcatctggaaacgctgctaaaggaggagacatcgcacaattttaga
caggacattaagaaatttcctgtgctcatttgtggtgacttcaattcatacatcaactcc
gccgtatacgaattgataaatacaggccgtgtccaaatacatcaagagggaaatggtaga
gatttcggttacatgtcggagaaaaatttctcacataacttggctctcaaatcaagttat
aattgtatcggagaactaccattcaccaatttcacaccgtcattcacagatgttatcgac
tatatatggttttctacacatgctctaagggtgcgtgggctattgggtgaagtggaccct
gaatacgtgagtaagtttatcgggttccccaacgacaaattccccagtgaccatatacca
ttgttagcaagatttgaatttatgaagacaaacacaggcagtaagaaagtataa

DBGET integrated database retrieval system