KEGG   Saccharomyces cerevisiae (budding yeast): YAL023CHelp
Entry
YAL023C           CDS       T00005                                 

Gene name
PMT2, FUN25
Definition
Pmt2p (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:sce00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
I:complement(106272..108551)
Genome map
AA seq 759 aa AA seqDB search
MSSSSSTGYSKNNAAHIKQENTLRQRESSSISVSEELSSADERDAEDFSKEKPAAQSSLL
RLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML
VGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTV
WLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITG
ISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCI
FLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSL
LHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVH
KSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTS
FRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPED
FQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNP
KYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWG
LHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMAL
VIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIADKQEA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgtcttcgtctaccgggtacagcaaaaacaatgccgcccacattaagcaagag
aatacactgagacaaagagaatcgtcttccatcagcgtcagtgaggaactttcgagcgct
gatgagagagacgcggaagatttctcgaaggaaaagcccgctgcacaaagctcactgtta
cgcctggaatccgttgtaatgccggtgatctttactgcattggcgttgtttaccaggatg
tacaaaatcggcatcaacaaccatgttgtttgggatgaggcgcactttggtaaatttggt
tcttattacttgagacacgaattttaccacgatgtccatcctcccctaggaaaaatgctg
gtcgggttgtctggttatttggcaggctacaacggttcttgggacttcccttctggggaa
atttacccagactatttggattatgttaaaatgagactgttcaacgcgtcattttccgcg
ctctgtgtgccattggcctacttcactgccaaagctattggattttctttaccaacagtt
tggctgatgaccgtgttggttttgtttgaaaactcgtatagtactttgggcaggttcatt
cttttggactccatgctacttttcttcactgtcgcatcgttctttagttttgttatgttc
cacaaccagaggtccaagccgttctctagaaagtggtggaaatggctgttgatcactggt
atttctttgggttgcactatttccgtcaaaatggtgggtctatttatcatcactatggtc
ggtatctatactgtgattgacttatggacctttttggcagataaatccatgtcatggaaa
acctatattaaccactggttggcaagaatatttggtcttattatcgtccccttctgcatt
ttcctattgtgcttcaaaatacattttgacctattatcgcattctggtacaggtgatgct
aacatgccatctcttttccaagcaagattagtgggttctgacgtcggacaaggcccccgt
gacattgctctaggttcctccgttgtttccatcaaaaaccaagctcttggaggatctcta
ttgcactcacatatacaaacttatccagatgggtccaaccaacaacaagtaacctgttat
ggttacaaagatgctaacaacgaatggtttttcaacagagaaagaggcttaccatcatgg
tcagaaaacgaaactgacatcgagtatttgaagccaggtacctcctatagattggtacac
aaaagcacgggcagaaacttgcacacccacccagttgctgcaccagtgtcaaagacacaa
tgggaggtttctggttacggtgacaatgttgttggtgacaacaaagacaattgggttatt
gagatcatggaccaaagaggagatgaagaccctgagaagttgcacacattgaccacctct
ttccgtatcaagaacttggagatgggctgttacttggctcaaaccggtaacagtttgccc
gaatggggtttcagacaacaagaggttgtctgcatgaaaaacccattcaagagggacaag
aggacctggtggaacatcgagacccacgaaaatgaaaggttgccaccaagacccgaagat
tttcaatacccaaagaccaacttcttaaaagacttcattcatttaaatctagccatgatg
gccactaataacgctttggtgccagatccagacaaatttgattacttagcttcctcagca
tggcaatggccaactttgaatgtgggtttgagactatgtggctggggtgatgataatcca
aaatacttcctattgggtaccccagcttccacgtgggcttctagtgttgccgtcctcgca
ttcatggccacggtcgttatcttactgatcagatggcaaagacaatatgtggacctaaga
aatccatctaactggaacgttttcttaatgggcgggttctacccactactagcttggggc
ctacactacatgccattcgttatcatgtctagagtcacctacgttcatcattacttgcct
gccttgtattttgcactgatcattttggcgtactgtttcgacgccggtttgcaaaaatgg
tccagatctaagtgcggccgtatcatgcggttcgtcctatacgccggattcatggcactt
gtaattggttgcttctggtacttctccccaatatcatttggtatggagggaccaagtagt
aacttccgctacttaaactggttttccacttgggacattgccgacaagcaagaagcatga

DBGET integrated database retrieval system