KEGG   Saccharomyces cerevisiae (budding yeast): YAL029CHelp
Entry
YAL029C           CDS       T00005                                 

Gene name
MYO4, FUN22, SHE1
Definition
myosin 4
Orthology
K10357  
myosin V
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(87855..92270)
Genome map
AA seq 1471 aa AA seqDB search
MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT
LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL
YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR
YFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENT
TIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGG
QPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSE
EQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFD
WLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH
VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLY
SAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNP
IFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVH
YIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDY
SLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKM
NEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIR
ALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLK
RSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEMLNDS
YTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTLNKKNALKERKKK
QSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQDFTTTYSANKNDKVKGL
GIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGYLKKVNVTEVNGDNVLGPI
HVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFA
ANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVL
NEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKC
PALNWKYGYEVDRNIERLVSWFEPRIEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFW
YALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRENLSLPGKMEIMLSAQFDSAK
NHLRYDTSAITQNSNTEGLATVSKIIKLDRK
NT seq 4416 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaagtaggaactaagtgttggtaccctcacaaagaacaaggctggataggc
ggcgaagtcaccaagaatgacttctttgaaggaacgttccacttagagttgaaattggag
gatggagaaactgtatccattgaaacaaatagcttcgaaaatgatgatgatcatcccacg
ctacctgtactacgaaacccacctattttagagtctactgatgacttaaccaccctatca
tatctgaacgaaccggcagtgctgcatgccataaaaaaaagatacatgaatggacagata
tatacttactctggtattgtccttattgccgctaatccctttgataaagtcgaccatttg
tactctcgcgagatgatacagaattattctagtaagcgtaaagatgagctggagccgcac
ctttttgccatagcagaggaggcgtacaggttcatggtccatgaaaaggctaaccagact
gttgtagtcagtggtgaatccggtgctggtaagaccgtctctgctaaatacattatgaga
tactttgcctcagtccaagaaagcaacaatcgtgaaggggaagtggaaatgtctcaaatc
gagagccaaattttagctactaacccgatcatggaagcctttggtaacgccaaaactacc
agaaatgataattcctctcgtttcggcaaatatctgcaaattttatttgatgagaatact
accatcagggggtccaaaattagaacctatctcttggaaaaatccaggttagtttatcag
ccagagacagaaagaaattaccatattttttaccaaattttggaaggattgccagaaccg
gtaaaacaagaactgcatttgtcatctcccaaggactaccattatactaaccaaggtgga
cagccgaacatagctggtatagatgaagctcgagaatacaagataaccactgatgccctg
tcattagtaggtataaaccacgagactcagcttggaattttcaaaattcttgcaggcttg
ctacatataggtaatatcgagatgaaaatgactagaaacgacgcatcactatcatcggaa
gagcaaaacctgcaaatcgcatgtgaattattgggtattgatcccttcaattttgcaaaa
tggattgtcaagaaacaaatcgtcacaaggtctgaaaaaattgtcactaatttgaattac
aatcaagcgctaattgctagggactctgtggcgaaatttatttattccacgctttttgat
tggctagtagacaacattaacaagacattatacgatcctgagctggatcaacaagatcat
gtcttttcctttattggtattttagatatctacgggtttgagcattttgagaaaaactca
ttcgaacaattctgtataaactatgcgaatgaaaaattacaacaagagttcaaccagcac
gttttcaaattggagcaagaagaatatgtaaaggaggaaattgagtggtctttcattgag
ttcagcgacaaccaaccttgcatagacttgattgagaataaacttggaatactttctcta
ttagatgaagaaagtagattaccatcaggctcagatgaatcatgggcctcaaaactatat
tctgcctttaataaaccgccctcaaatgaagttttttcgaagccaagattcggacaaacg
aagtttatagtaagccattatgctgttgatgtagaatatgaagttgaagggtttattgaa
aagaatagagacagcgtttccctaggtcatctggatgttttcaaagcaacgacaaatcca
attttcaaacaaattttagacaacagagaacttaggagtgacgatgctcctgaagagcaa
aatactgaaaaaaagataatgatcccagcaagattaagtcaaaagaaaccaaccctggga
tctatgttcaaaaaatcgctcggggaattgatggccatcataaattctactaatgttcat
tatattcgttgcataaaaccaaattctgaaaaaaagccatgggagttcgataatttgatg
gtcttatcgcaattaagagcttgtggtgtgctggaaacaatcaggatttcatgtgcaggc
tttccatcaagatggacttttgacgaattcgttcaaagatatttcctcctgacggactac
agcttatggagtggaattctttataatccagacctcccaaaagaggcaatcgtcaacttc
tgtcaatctattctagatgctactatctctgattcagcaaaataccaaattggtaatacc
aaaattttctttaaagcaggaatgcttgcatttttggaaaagctaaggactaataaaatg
aatgaaatatgcatcataatacagaaaaagataagggcaagatactataggcttcagtat
ttgcagaccatggaatcaataaagaagtgccaaagccaaattagaagtttgttggttcgt
acaagggtcgatcatgagctcaagacaagagctgccatattactacaaacgaacattaga
gcattatggaaacgggaatactatagagctgccattgggcaaataataaaactacaatgt
acctgtaaaagaaaattgattttagatagtgttaacaggaaattcatgctcatggcggca
gtaattatccaaagctacatcagatcatatggtcacaaaacagattacagaacattgaaa
aggagctccattcttgtacaaagcgccatgagaatgcagttagctagacgaaggtatata
gttctgcaaaaagaagttgaagaacggaatattagggctagttacgggattggattactg
gaggaagctatcgaatttaagaactctttcattttgaatctagagatgttaaatgactca
tatacaagattaacacagttgttgcagggagatttgtcaaatattccatctaagcaaagg
caagagtacgaaacgatagtaaatggttataatgataagatttccaagctgaagacgtta
caagttgaaatcatgaatactttaaacaagaagaatgccttgaaggagagaaaaaagaag
caatcttctttaatacagtcacatatgcaaagtttggctgctataaaaggtaacaaacct
tcaagattaagtgatgaagtcaaatcaatgaagcaagaactagcgtttattgaaaacgta
atagcacaagatttcaccaccacatattctgctaataagaatgataaagtgaaaggtttg
ggaatcgcaggacaacaagtaaaaccgaagctagtcaatgtaattcgtagagaatcagga
aatcctgatcttctagaattactaatggacctgaattgttacacattagaagtcacagaa
ggttacttgaaaaaagtaaatgttactgaggtgaatggagacaatgttctgggtcctata
cacgtcattactacagtggtaagtagcttagtgagaaatgggttattgattcaaagtagc
aaattcatctcgaaagtcctattgactgtagaaagcattgttatgagtctaccaaaggac
gaaacaatgcttggtggtatcttttggttaagtaatctttccagacttcccgcatttgct
gcaaatcaaaaaacattatatgaagcgaatggtggtgatgaaaaagataagttaacactg
atatatttgaatgatttggagaatgaaactttaaaagtattcgacaagatttattccact
tggttagtgaaattcatgaagcatgcttcagcccacatcgagatcttcgatatggtttta
aacgagaagctatttaaaaattctggtgatgagaagttcgctaaattattcacattctta
aatgaatttgatgctgtcttgtgtaaatttcaagttgttgactcaatgcatacaaaaatt
tttaacgacaccctgaagtatctgaacgtaatgctatttaatgacctaataaccaaatgt
cccgcgttaaattggaagtatgggtacgaagtggatagaaatatcgagcggttggtgagc
tggtttgaaccaagaattgaagacgttcgtcccaatttgattcaaataattcaggctgtc
aagatattacagttgaagataagcaacttgaacgagttcaagttactattcgatttctgg
tatgccttgaatccagcccaaatacaagcaattctgttgaaatacaagcctgctaacaag
ggcgaagctggagtaccgaacgaaatcttgaattatttagctaacgtgatcaaaagagaa
aatctgtctttgccagggaagatggaaattatgctttctgcccaatttgactctgctaaa
aaccatctgcgttatgacactagtgcaataacacagaacagcaatacagagggcttagct
actgtcagtaaaattataaaattagacagaaaataa

DBGET integrated database retrieval system