KEGG   Saccharomyces cerevisiae (budding yeast): YAL040CHelp
Entry
YAL040C           CDS       T00005                                 

Gene name
CLN3, DAF1, FUN10, WHI1
Definition
Cln3p
Orthology
K06646  
G1/S-specific cyclin CLN3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YAL040C (CLN3)
   04113 Meiosis - yeast
    YAL040C (CLN3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
I:complement(65778..67520)
Genome map
AA seq 580 aa AA seqDB search
MAILKDTIIRYANARYATASGTSTATAASVSAASCPNLPLLLQKRRAIASAKSKNPNLVK
RELQAHHSAISEYNNDQLDHYFRLSHTERPLYNLTNFNSQPQVNPKMRFLIFDFIMYCHT
RLNLSTSTLFLTFTILDKYSSRFIIKSYNYQLLSLTALWISSKFWDSKNRMATLKVLQNL
CCNQYSIKQFTTMEMHLFKSLDWSICQSATFDSYIDIFLFQSTSPLSPGVVLSAPLEAFI
QQKLALLNNAAGTAINKSSSSQGPSLNINEIKLGAIMLCELASFNLELSFKYDRSLIALG
AINLIKLSLNYYNSNLWENINLALEENCQDLDIKLSEISNTLLDIAMDQNSFPSSFKSKY
LNSNKTSLAKSLLDALQNYCIQLKLEEFYRSQELETMYNTIFAQSFDSDSLTCVYSNATT
PKSATVSSAATDYFSDHTHLRRLTKDSISPPFAFTPTSSSSSPSPFNSPYKTSSSMTTPD
SASHHSHSGSFSSTQNSFKRSLSIPQNSSIFWPSPLTPTTPSLMSNRKLLQNLSVRSKRL
FPVRPMATAHPCSAPTQLKKRSTSSVDCDFNDSSNLKKTR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccatattgaaggataccataattagatacgctaatgcaaggtatgctaccgctagt
ggcacttccaccgccactgccgcctctgtcagcgctgcctcatgtcctaatttgcccttg
ctcttgcaaaagaggcgggccattgctagtgcaaagtctaaaaaccctaatctcgttaaa
agagaattgcaagcacatcactcagcgatcagcgaatacaataatgatcaattggaccac
tatttccgtctttcccacacagaaaggccgctgtacaacctgactaacttcaactctcag
ccacaagttaatccgaagatgcgtttcttgatctttgacttcatcatgtactgtcacaca
agactcaatctatcgacctcgactttgttccttactttcactatcttggacaagtattcc
tcgcggttcattatcaagagttacaactaccagctcttgtccttgaccgcgctttggatt
tcgtccaaattttgggactccaagaatagaatggccactttgaaagtcttgcaaaacttg
tgttgcaatcaatattctataaagcaattcacgactatggaaatgcatcttttcaaatca
ctcgattggtccatctgtcagtcggcaacattcgactcctacatcgacatcttcttgttc
caatctacgtccccgttatcgcctggcgttgtcctttctgcccctttggaagctttcatt
caacagaaactggccttattaaataacgctgctggtactgctattaataaatcgtcctct
tctcaaggcccctctttgaacatcaacgagatcaaattgggtgccattatgttgtgcgag
ttagcttccttcaatctcgaattatcatttaaatatgatcgttcactaattgcgctgggt
gcaattaacctcatcaaattatctttgaactactataattcaaacctttgggaaaatatc
aatctggctttggaggaaaactgccaagacctagatattaaattgtcagaaatctctaat
actttattggatatagcaatggaccaaaattctttcccctccagtttcaaatcaaaatat
ttgaatagcaataagacatctttagcaaaatctctcttagacgcattacaaaactattgt
attcaattgaaactggaagaattctaccgttcacaagaattggaaaccatgtacaatact
atctttgctcagtcctttgacagcgattcattgacttgtgtttactcaaatgctactact
ccaaagagcgctacggtttcatctgcggccacagactatttctcggatcacactcattta
agaaggttgaccaaagatagcatttctccaccatttgccttcactccaacctcatcttca
tcctctccatctccattcaattccccttacaagacttcaagttcaatgacgaccccagac
tctgcatcacaccattcacattcaggttcgttctcttctacccaaaattcttttaaaagg
tcactgagcatcccacaaaattcaagcatcttttggccaagcccactaactcccaccacc
ccatctctaatgtcaaatagaaaattattacaaaatttatctgtgcgttcaaaaagatta
tttcctgttagacccatggccactgctcacccatgctctgcccccacccaactgaaaaag
agatcaacttcctctgtggattgtgattttaatgatagtagcaacctcaagaaaactcgc
tga

DBGET integrated database retrieval system