KEGG   Saccharomyces cerevisiae (budding yeast): YAL054CHelp
Entry
YAL054C           CDS       T00005                                 

Gene name
ACS1, FUN44
Definition
acetate--CoA ligase 1 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YAL054C (ACS1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YAL054C (ACS1)
   00620 Pyruvate metabolism
    YAL054C (ACS1)
   00640 Propanoate metabolism
    YAL054C (ACS1)
  Energy metabolism
   00680 Methane metabolism
    YAL054C (ACS1)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YAL054C (ACS1)
Lipid biosynthesis proteins [BR:sce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YAL054C (ACS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(42881..45022)
Genome map
AA seq 713 aa AA seqDB search
MSPSAVQSSKLEEQSSEIDKLKAKMSQSAATAQQKKEHEYEHLTSVKIVPQRPISDRLQP
AIATHYSPHLDGLQDYQRLHKESIEDPAKFFGSKATQFLNWSKPFDKVFIPDPKTGRPSF
QNNAWFLNGQLNACYNCVDRHALKTPNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVL
TYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVV
ITTDESNRGGKVIETKRIVDDALRETPGVRHVLVYRKTNNPSVAFHAPRDLDWATEKKKY
KTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTA
GDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLL
KRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVT
PLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNH
DRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPI
VAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPK
LIILVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSNPGIVRHLIDSVKL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctctgccgtacaatcatcaaaactagaagaacagtcaagtgaaattgacaag
ttgaaagcaaaaatgtcccagtctgccgccactgcgcagcagaagaaggaacatgagtat
gaacatttgacttcggtcaagatcgtgccacaacggcccatctcagatagactgcagccc
gcaattgctacccactattctccacacttggacgggttgcaggactatcagcgcttgcac
aaggagtctattgaagaccctgctaagttcttcggttctaaagctacccaatttttaaac
tggtctaagccattcgataaggtgttcatcccagaccctaaaacgggcaggccctccttc
cagaacaatgcatggttcctcaacggccaattaaacgcctgttacaactgtgttgacaga
catgccttgaagactcctaacaagaaagccattattttcgaaggtgacgagcctggccaa
ggctattccattacctacaaggaactacttgaagaagtttgtcaagtggcacaagtgctg
acttactctatgggcgttcgcaagggcgatactgttgccgtgtacatgcctatggtccca
gaagcaatcataaccttgttggccatttcccgtatcggtgccattcactccgtagtcttt
gccgggttttcttccaactccttgagagatcgtatcaacgatggggactctaaagttgtc
atcactacagatgaatccaacagaggtggtaaagtcattgagactaaaagaattgttgat
gacgcgctaagagagaccccaggcgtgagacacgtcttggtttatagaaagaccaacaat
ccatctgttgctttccatgcccccagagatttggattgggcaacagaaaagaagaaatac
aagacctactatccatgcacacccgttgattctgaggatccattattcttgttgtatacg
tctggttctactggtgcccccaagggtgttcaacattctaccgcaggttacttgctggga
gctttgttgaccatgcgctacacttttgacactcaccaagaagacgttttcttcacagct
ggagacattggctggattacaggccacacttatgtggtttatggtcccttactatatggt
tgtgccactttggtctttgaagggactcctgcgtacccaaattactcccgttattgggat
attattgatgaacacaaagtcacccaattttatgttgcgccaactgctttgcgtttgttg
aaaagagctggtgattcctacatcgaaaatcattccttaaaatctttgcgttgcttgggt
tcggtcggtgagccaattgctgctgaagtttgggagtggtactctgaaaaaataggtaaa
aatgaaatccccattgtagacacctactggcaaacagaatctggttcgcatctggtcacc
ccgctggctggtggtgttacaccaatgaaaccgggttctgcctcattccccttcttcggt
attgatgcagttgttcttgaccctaacactggtgaagaacttaacaccagccacgcagag
ggtgtccttgccgtcaaagctgcatggccatcatttgcaagaactatttggaaaaatcat
gataggtatctagacacttatttgaacccttaccctggctactatttcactggtgatggt
gctgcaaaggataaggatggttatatctggattttgggtcgtgtagacgatgtggtgaac
gtctctggtcaccgtctgtctaccgctgaaattgaggctgctattatcgaagatccaatt
gtggccgagtgtgctgttgtcggattcaacgatgacttgactggtcaagcagttgctgca
tttgtggtgttgaaaaacaaatctagttggtccaccgcaacagatgatgaattacaagat
atcaagaagcatttggtctttactgttagaaaagacatcgggccatttgccgcaccaaaa
ttgatcattttagtggatgacttgcccaagacaagatccggcaaaattatgagacgtatt
ttaagaaaaatcctagcaggagaaagtgaccaactaggcgacgtttctacattgtcaaac
cctggcattgttagacatctaattgattcggtcaagttgtaa

DBGET integrated database retrieval system