KEGG   Saccharomyces cerevisiae (budding yeast): YAR009CHelp
Entry
YAR009C           CDS       T00005                                 

Definition
truncated gag-pol fusion protein (EC:3.1.26.4 2.7.7.7 2.7.7.49)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
I:complement(160597..164187)
Genome map
AA seq 1196 aa AA seqDB search
METFTGYLKSTCFHQISPYPPSIMSIQVKVHANILILSFIECLRMPMHRQIRYSLKNNTI
TYFNESDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNL
PKSAPSYFISFTDETTKLRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGS
EYTNRTLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSA
IEFSTIVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPVIVNDHNPNSKIHPRGIPGY
ALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFNYDALTFDEDLNRLTASYHS
FIASNEIQESNDLNIESDHDFQSDIELHPEQPRNVLSKAVSPTDSTPPSTHTEDSKRVSK
TNIRAPREVDPNISESNILPSKKRSSTPQISNIESTGSGGMHKLNVPLLAPMSQSNTHES
SHASKSKDFRHSDSYSENETNHTNVPISSTGGTNNKTVPQISDQETEKRIIHRSPSIDAS
PPENNSSHNIVPIKTPTTVSEQNTEESIIADLPLPDLPPESPTEFPDPFKELPPINSHQT
NSSLGGIGDSNAYTTINSKKRSLEDNETEIKVSRDTWNTKNMRSLEPPRSKKRIHLIAAV
KAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIEAYHKEVNQLLKMNTWDTDKYYDRKEID
PKRVINSMFIFNKKRDGTHKARFVARGDIQHPDTYDTGMQSNTVHHYALMTSLSLALDNN
YYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKSLYGLKQSGANWYETIKSYL
IKQCGMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANKKIITTLKKQYDTKIINLGE
SDNEIQYDILGLEIKYQRGKYMKLGMEKSLTEKLPKLNVPLNPKGKKLRAPGQPGLYIDQ
DELEIDEDEYKEKVHEMQKLIGLASYVGYKFRFDLLYYINTLAQHILFPSRQVLDMTYEL
IQFMWDTRDKQLIWHKNKPTEPDNKLVAISDASYGNQPYYKSQIGNIYLLNGKVIGGKST
KASLTCTSTTEAEIHAISESVPLLNNLSYLIQELNKKPIIKGLLTDSRSTISIIKSTNEE
KFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKPLPIKTFKLLTNKWIH
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atggagacttttactgggtatctaaaaagtacttgcttccatcaaatatctccgtaccca
ccatcaataatgtccatacaagtgaaagtacacgcaaatatccttatcctttcattcatc
gaatgcttgcgcatgccaatgcacagacaaattcgatactcacttaaaaataacaccatc
acgtattttaacgaatcagatgtcgactggtctagtgctattgactatcaatgtcctgat
tgtttaatcggcaaaagcaccaaacacagacatatcaaaggttcacgactaaaataccaa
aattcatacgaaccctttcaatacctacatactgacatatttggtccagttcacaaccta
ccaaaaagtgcaccatcctatttcatctcatttactgatgagacaacaaaattgcgttgg
gtttatccattacacgaccgtcgcgaggactctatcctcgatgtttttactacgatacta
gcttttattaaaaaccagtttcaggccagtgtcttggttatacaaatggaccgtggttct
gagtatactaacagaactctccataaattccttgaaaaaaatggtataactccatgctat
acaaccacagcggattcccgagcacatggagtcgctgaacggctaaaccgtaccttatta
gatgactgccgtactcaactgcaatgtagtggtttaccgaaccatttatggttctctgca
atcgaattttctactattgtgagaaattcactagcttcacctaaaagcaaaaaatctgca
agacaacatgctggcttggcaggacttgatatcagtactttgttacctttcggtcaacct
gttatcgtcaatgatcacaaccctaactccaaaatacatcctcgtggcatcccaggctac
gctctacatccgtctcgaaactcttatggatatatcatctatcttccatccttaaagaag
acagtagatacaactaactatgttattcttcagggcaaggaatccagattagatcaattc
aattacgacgcactcactttcgatgaagacttaaaccgtttaactgcttcatatcattcg
ttcattgcgtcaaatgagatccaagaatccaatgatcttaacatagaatctgaccatgac
ttccaatccgacattgaactacatcctgagcaaccgagaaatgtcctttcaaaagctgtg
agtccaaccgattccacacctccgtcaactcatactgaagattcgaaacgtgtttctaaa
accaatattcgcgcacccagagaagttgaccccaacatatctgaatctaatattcttcca
tcaaagaagagatctagcaccccccaaatttccaatatcgagagtaccggttcgggtggt
atgcataaattaaatgttcctttacttgctcccatgtcccaatctaacacacatgagtcg
tcgcacgccagtaaatctaaagatttcagacactcagactcgtacagtgaaaatgagact
aatcatacaaacgtaccaatatccagtacgggtggtaccaacaacaaaactgttccgcag
ataagtgaccaagagactgagaaaaggattatacaccgttcaccttcaatcgatgcttct
ccaccggaaaataattcatcgcacaatattgttcctatcaaaacgccaactactgtttct
gaacagaataccgaggaatctatcatcgctgatctcccactccctgatctacctccagaa
tctcctaccgaattccctgacccatttaaagaactcccaccgataaattctcatcaaact
aattccagtttgggtggtattggtgactctaatgcctatactactatcaacagtaagaaa
agatcattagaagataatgaaactgaaattaaggtatcacgagacacatggaatactaag
aatatgcgtagtttagaacctccgagatcgaagaaacgaattcacctgattgcagctgta
aaagcagtaaaatcaatcaaaccaatacggacaaccttacgatacgatgaggcaatcacc
tataataaagatattaaagaaaaagaaaaatatatcgaggcataccacaaagaagtcaac
caactattgaaaatgaatacttgggacactgacaaatattatgacagaaaagaaatagac
cctaaaagagtaataaactcaatgtttatcttcaacaagaaacgtgacggaactcataaa
gctagatttgttgcaagaggtgacattcagcatcctgatacgtacgatacaggtatgcaa
tccaacactgtacatcattatgcgttgatgacatccctgtcacttgcattagacaataac
tactatattacacaattagacatatcttcggcatatttgtatgcagacatcaaagaagaa
ttatacataagacctccaccacatttaggaatgaatgataagttgatacgtttgaagaaa
tcactttatggattgaaacaaagtggagcgaactggtacgaaactatcaaatcatacctg
ataaaacagtgtggtatggaagaagttcgtggatggtcatgcgtatttaagaatagtcaa
gtaacaatttgcttattcgttgatgatatgatattgttcagcaaagacttaaatgcaaat
aagaaaatcataacaacactcaagaaacaatacgatacaaagataataaatctgggtgaa
agtgataacgaaattcagtacgacatacttggcttagaaatcaaatatcaaagaggtaaa
tacatgaaattaggtatggaaaaatccttgacagaaaaattacccaaactaaacgtacct
ttgaacccaaaaggaaagaaacttagagctccaggtcaaccaggtctttatatagaccag
gatgaactagaaatagatgaagatgaatacaaagagaaggtacatgaaatgcaaaagttg
attggtctagcttcatatgttggatataaatttagatttgacttactatactacatcaac
acacttgctcaacatatactattcccctctaggcaagttttagacatgacatatgagttg
atacaattcatgtgggacactagagataaacaactgatatggcacaaaaacaaacctacc
gagccagataataaactagtcgcaataagtgatgcttcgtatggcaaccaaccgtattat
aaatcacaaattggcaacatatatttacttaatggaaaggtaattggaggaaagtccacc
aaggcttcattaacatgtacttcaactacggaagcagaaatacacgcgataagtgaatct
gtcccattattaaataatctaagttacctgatacaagaacttaacaagaaaccaattatt
aaaggcttacttactgatagtagatcaacgatcagtataattaagtctacaaatgaagag
aaatttagaaacagattttttggcacaaaggcaatgagacttagagatgaagtatcaggt
aataatttatacgtatactacatcgagaccaagaagaacattgctgatgtgatgacaaaa
cctcttccgataaaaacatttaaactattaactaacaaatggattcattag

DBGET integrated database retrieval system