KEGG   Saccharomyces cerevisiae (budding yeast): YBL002WHelp
Entry
YBL002W           CDS       T00005                                 

Gene name
HTB2
Definition
Htb2p
Orthology
K11252  
histone H2B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:236492..236887
Genome map
AA seq 131 aa AA seqDB search
MSSAAEKKPASKAPAEKKPAAKKTSTSVDGKKRSKVRKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgccgccgaaaagaaaccagcttccaaagctccagctgaaaagaagccagct
gccaagaaaacatcaacctccgtcgatggtaagaagagatctaaggttagaaaggagacc
tattcctcttatatttacaaagttttgaagcaaactcacccagacactggtatttcccag
aagtctatgtctattttgaactctttcgttaacgatatctttgaaagaattgctactgaa
gcttctaaattggccgcttataacaagaaatccactatttctgctagagaaatccaaaca
gccgttagattgatcttacctggtgaattggctaaacatgccgtctccgaaggtactagg
gctgttaccaaatactcctcctctactcaagcctaa

DBGET integrated database retrieval system