KEGG   Saccharomyces cerevisiae (budding yeast): YBL002WHelp
Entry
YBL002W           CDS       T00005                                 

Gene name
HTB2
Definition
Htb2p
Orthology
K11252  
histone H2B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YBL002W (HTB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:236492..236887
Genome map
AA seq 131 aa AA seqDB search
MSSAAEKKPASKAPAEKKPAAKKTSTSVDGKKRSKVRKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgccgccgaaaagaaaccagcttccaaagctccagctgaaaagaagccagct
gccaagaaaacatcaacctccgtcgatggtaagaagagatctaaggttagaaaggagacc
tattcctcttatatttacaaagttttgaagcaaactcacccagacactggtatttcccag
aagtctatgtctattttgaactctttcgttaacgatatctttgaaagaattgctactgaa
gcttctaaattggccgcttataacaagaaatccactatttctgctagagaaatccaaaca
gccgttagattgatcttacctggtgaattggctaaacatgccgtctccgaaggtactagg
gctgttaccaaatactcctcctctactcaagcctaa

DBGET integrated database retrieval system