KEGG   Saccharomyces cerevisiae (budding yeast): YBL005W-AHelp
Entry
YBL005W-A         CDS       T00005                                 

Definition
gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:221330..222652
Genome map
AA seq 440 aa AA seqDB search
MESQQLSQHSPIFHGSACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPPS
SAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQANISGWPVYGHPSLMPYPPYQMSPM
YAPPGAQSQFTQYPQYVGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPND
FLNWVKIYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFAPSQFLPPWVKDI
LSVDYTDIMKILSKSINKMQSDTQEVNDITTLATLHYNGSTPADAFEAEVTNILDRLNNN
GIPINNKVACQFIMRGLSGEYKFLPYARHRCIHMTVADLFSDIHSMYEEQQESKRNKSTY
RRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTFNNSPGPDNDLIRGS
TTEPIQLKNTHDLHLRPGTY
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccaacaattatctcaacattccccgatttttcatggtagcgcctgtgcttcg
gttacttctaaagaagtccaaacaactcaagatccgttagacatttcagcttccaaaaca
gaagaatgtgagaaggtttccactcaggctaattctcaacagccaacaacacctccctca
tctgctgttccagagaaccatcatcatgcctctcctcaagctgctcaagtaccattgcca
caaaatgggccgtacccacagcagcgcatgatgaatacccaacaagccaatatttctggc
tggccagtatacgggcacccatccttgatgccgtatccaccttatcaaatgtcacctatg
tacgctccacctggggcacaatcacagtttacacaatatccacaatatgttggaacacat
ttgaacaccccgtcacctgagtcaggtaattcatttcctgattcatcctcagcaaagtct
aatatgacatccactaatcaacatgtcagaccaccgccaatcttaacctcacctaatgac
tttctaaattgggttaaaatatacatcaaatttttacaaaattcgaatctcggtgatatt
attccgacagcaacaagaaaagccgtacgtcagatgactgatgacgaactcaccttctta
tgtcacacctttcaactatttgctccatctcaattcttacccccctgggttaaagacatc
ttatctgttgattatacagatatcatgaaaattctttccaaaagcattaacaaaatgcag
tctgatactcaagaggtaaatgacattacgaccctagcaactttgcattataatggaagt
acacctgcagatgcatttgaagcagaagtcacaaacattcttgacagactaaacaacaat
ggcattcctatcaataacaaggtagcatgccaattcattatgagaggtctatctggcgag
tacaaatttttaccgtacgcacgtcatcgatgtatacatatgacagttgctgatctgttt
tcagacatacattctatgtatgaagaacaacaggaatcaaaacgtaataaatctacttat
aggagaagtccgagtgatgagaagaaagactctcgcacctatacgaatacaaccaaaccc
aaatccataactcggaattcccaaaaaccaaataattcgcaatcaagaacagccagggct
cataacgtatccacatttaataactctcccggccctgataacgatctcataagaggatcg
actactgaaccgattcaattgaagaatacacacgaccttcaccttaggccaggaacttac
tga

DBGET integrated database retrieval system