KEGG   Saccharomyces cerevisiae (budding yeast): YBL016WHelp
Entry
YBL016W           CDS       T00005                                 

Gene name
FUS3, DAC2
Definition
Fus3p (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Cell cycle - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:sce04011]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:192451..193512
Genome map
AA seq 353 aa AA seqDB search
MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREI
KILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQ
TLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMT
EYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIG
TPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITA
KEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagagaattgtatacaatatatccagtgacttccagttgaagtcgttactggga
gagggtgcatacggtgtggtatgttctgcaacgcataagcccacgggagaaatcgtggca
ataaaaaagatcgaaccattcgataagcctttgttcgcattacgtacgctgcgtgaaata
aagatcctgaagcacttcaagcacgaaaatatcataacaatcttcaacattcaacgccct
gactcgttcgaaaacttcaatgaggtctacataattcaagagctaatgcagacagattta
caccgtgtaatctccacccagatgctgagtgacgatcatatacaatattttatataccaa
accttgagagcagtgaaagtgctgcatggttcgaacgtcatccatcgtgatttaaagccc
tccaaccttctcataaactccaactgtgacttgaaagtatgtgatttcggtttagcaaga
atcattgacgagtcagccgcggacaattcagagcccacaggtcagcaaagcggcatgacc
gagtatgtggccacacgttggtacagggcgccagaggtgatgttaacctctgccaaatac
tcaagggccatggacgtgtggtcctgcggatgtattctcgctgaacttttcttaagacgg
ccaatcttccctggcagagattatcgccatcaactactactgatattcggtatcatcggt
acacctcactcagataatgatttgcggtgtatagagtcacccagggctagagagtacata
aagtcgcttcccatgtaccctgccgcgccactggagaagatgttccctcgagtcaacccg
aaaggcatagatcttttacagcgtatgcttgtttttgaccctgcgaagaggattactgct
aaggaggcactggagcatccgtatttgcaaacataccacgatccaaacgacgaacctgaa
ggcgaacccatcccacccagcttcttcgagtttgatcactacaaggaggcactaacgacg
aaagacctcaagaaactcatttggaacgaaatatttagttag

DBGET integrated database retrieval system