KEGG   Saccharomyces cerevisiae (budding yeast): YBL023CHelp
Entry
YBL023C           CDS       T00005                                 

Gene name
MCM2
Definition
Mcm2p (EC:3.6.4.12)
Orthology
K02540  
DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:sce03030]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(174920..177526)
Genome map
AA seq 868 aa AA seqDB search
MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPD
IDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERD
RLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREE
LTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSE
SLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDF
PTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIR
ISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKP
GEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEE
EREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVL
LLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLAD
KGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNST
LPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELK
NNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQ
MDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKV
VVDSFVDAQKVSVRRQLRRSFAIYTLGH
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatagaagacgtagacgtgaggaagatgattcggactcagaaaatgagcta
ccgccatcctcacctcagcaacattttagaggggggatgaacccagtttcatcacctatt
ggttctccagatatgattaaccctgaaggtgacgataatgaagttgacgatgtaccagat
attgatgaagttgaagaacaaatgaacgaagtagatttgatggacgataatatgtatgag
gattatgcggctgatcataatagagatagatatgatccagatcaagttgacgacagggaa
caacaagaactatctttaagcgaacgtcgccgcattgatgctcaactaaatgaaagagat
aggctattgagaaatgttgcctacatagatgacgaggacgaagaacaagaaggtgcagcg
caacttgatgaaatgggccttcctgtgcaaagacgaagaaggagaaggcagtatgaggac
ttagagaatagtgatgacgatctattgagtgacatggacattgacccattaagagaagaa
cttactttagaatctctgagtaacgttaaggctaacagttactcggaatggataacacaa
cctaatgtctcaagaactattgccagagagttaaaatcattcctgctggaatatacagat
gaaacgggtcgttctgtatatggtgcacgtattagaacattaggtgaaatgaattctgaa
tctttggaggttaattatagacacttagcggagtccaaagccatcctggcactattttta
gctaaatgtccagaagaaatgttgaaaatattcgatctcgtggctatggaggcaacagaa
ttgcattacccagattatgcccgtattcactccgaaattcacgtaagaatctctgatttt
ccaacaatatacagtttacgtgaattgcgtgagtctaatttgtcctctctagtacgcgtc
actggggtggtgacaagaagaacaggagtcttccctcaattaaaatatgtcaaattcaat
tgtttgaaatgtggctccattttgggcccattttttcaagattctaatgaagaaattaga
atctcattctgtacaaactgcaaatcaaaaggtccctttagagtcaatggagaaaaaact
gtgtaccgaaattatcaaagggttacgctccaggaagctcccggaaccgttcctccaggc
cgtctaccaagacatagagaagtcattttgttggcggatttggtagatgtatccaagcca
ggtgaagaggtagaagttaccggcatctacaaaaataactacgatggtaacttgaatgca
aagaacggattccccgtttttgcaacaattatcgaggcaaattctataaaaagaagagag
ggcaatacagctaacgaaggcgaagaagggttggatgttttcagttggactgaagaagaa
gaacgtgaatttagaaagatttctagggatcgtggtataattgataaaattatatcatcg
atggcaccgtctatctatggtcatagagatattaaaactgcagtcgcgtgctcattattt
ggaggtgttccaaaaaacgtcaatggaaaacattctattcgtggtgatatcaatgtgtta
ttattaggtgatccaggtactgccaaatctcaaatcttaaaatacgtcgagaaaacagcg
catagagcggtctttgcaactggtcagggtgcttcggctgtcggtctgacagcatccgtc
agaaaagatcctattactaaagaatggaccttagaagggggggcgctagtattggctgat
aagggtgtttgtttaattgatgaattcgataagatgaacgatcaggatcgtacatctatt
catgaggctatggaacagcaaagtatttccatttccaaggccggtattgttactacatta
caagcgcgctgctcaattattgctgcggcaaatcctaatggtggtagatataattcaacc
ttgcctttagctcagaatgttagtttgaccgagcctattctgtctagatttgatatttta
tgtgttgtcagagaccttgttgatgaagaggcagacgaaagattggccacatttgttgtc
gattctcatgtaagatctcatccagaaaacgatgaagatcgagaaggcgaagagcttaaa
aataatggcgaatcggcgatagaacaaggagaagatgaaataaatgagcagcttaatgca
aggcaaagaagacttcaaagacaaaggaagaaggaggaagagatctcgcctattccacag
gaattattgatgaaatatattcactatgcgaggacaaaaatataccctaaattgcatcag
atggatatggataaggttagcagggtatatgcggatttgagaagagaaagtatttctaca
ggttcgtttccaatcacagttcgtcatttagaatctattctaagaattgcagaatctttt
gctaaaatgagattatctgaatttgtgtcttcttatgatttggatagagctatcaaagtt
gtagttgattcctttgttgatgcccaaaaagtcagtgttcgccgccaactccgcaggtct
ttcgcaatttataccttgggtcactaa

DBGET integrated database retrieval system