KEGG   Saccharomyces cerevisiae (budding yeast): YBL023CHelp
Entry
YBL023C           CDS       T00005                                 

Gene name
MCM2
Definition
MCM DNA helicase complex subunit MCM2 (EC:3.6.4.12)
Orthology
K02540  
DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YBL023C (MCM2)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBL023C (MCM2)
   04113 Meiosis - yeast
    YBL023C (MCM2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YBL023C (MCM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(174920..177526)
Genome map
AA seq 868 aa AA seqDB search
MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPD
IDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERD
RLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREE
LTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSE
SLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDF
PTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIR
ISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKP
GEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEE
EREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVL
LLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLAD
KGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNST
LPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELK
NNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQ
MDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKV
VVDSFVDAQKVSVRRQLRRSFAIYTLGH
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatagaagacgtagacgtgaggaagatgattcggactcagaaaatgagcta
ccgccatcctcacctcagcaacattttagaggggggatgaacccagtttcatcacctatt
ggttctccagatatgattaaccctgaaggtgacgataatgaagttgacgatgtaccagat
attgatgaagttgaagaacaaatgaacgaagtagatttgatggacgataatatgtatgag
gattatgcggctgatcataatagagatagatatgatccagatcaagttgacgacagggaa
caacaagaactatctttaagcgaacgtcgccgcattgatgctcaactaaatgaaagagat
aggctattgagaaatgttgcctacatagatgacgaggacgaagaacaagaaggtgcagcg
caacttgatgaaatgggccttcctgtgcaaagacgaagaaggagaaggcagtatgaggac
ttagagaatagtgatgacgatctattgagtgacatggacattgacccattaagagaagaa
cttactttagaatctctgagtaacgttaaggctaacagttactcggaatggataacacaa
cctaatgtctcaagaactattgccagagagttaaaatcattcctgctggaatatacagat
gaaacgggtcgttctgtatatggtgcacgtattagaacattaggtgaaatgaattctgaa
tctttggaggttaattatagacacttagcggagtccaaagccatcctggcactattttta
gctaaatgtccagaagaaatgttgaaaatattcgatctcgtggctatggaggcaacagaa
ttgcattacccagattatgcccgtattcactccgaaattcacgtaagaatctctgatttt
ccaacaatatacagtttacgtgaattgcgtgagtctaatttgtcctctctagtacgcgtc
actggggtggtgacaagaagaacaggagtcttccctcaattaaaatatgtcaaattcaat
tgtttgaaatgtggctccattttgggcccattttttcaagattctaatgaagaaattaga
atctcattctgtacaaactgcaaatcaaaaggtccctttagagtcaatggagaaaaaact
gtgtaccgaaattatcaaagggttacgctccaggaagctcccggaaccgttcctccaggc
cgtctaccaagacatagagaagtcattttgttggcggatttggtagatgtatccaagcca
ggtgaagaggtagaagttaccggcatctacaaaaataactacgatggtaacttgaatgca
aagaacggattccccgtttttgcaacaattatcgaggcaaattctataaaaagaagagag
ggcaatacagctaacgaaggcgaagaagggttggatgttttcagttggactgaagaagaa
gaacgtgaatttagaaagatttctagggatcgtggtataattgataaaattatatcatcg
atggcaccgtctatctatggtcatagagatattaaaactgcagtcgcgtgctcattattt
ggaggtgttccaaaaaacgtcaatggaaaacattctattcgtggtgatatcaatgtgtta
ttattaggtgatccaggtactgccaaatctcaaatcttaaaatacgtcgagaaaacagcg
catagagcggtctttgcaactggtcagggtgcttcggctgtcggtctgacagcatccgtc
agaaaagatcctattactaaagaatggaccttagaagggggggcgctagtattggctgat
aagggtgtttgtttaattgatgaattcgataagatgaacgatcaggatcgtacatctatt
catgaggctatggaacagcaaagtatttccatttccaaggccggtattgttactacatta
caagcgcgctgctcaattattgctgcggcaaatcctaatggtggtagatataattcaacc
ttgcctttagctcagaatgttagtttgaccgagcctattctgtctagatttgatatttta
tgtgttgtcagagaccttgttgatgaagaggcagacgaaagattggccacatttgttgtc
gattctcatgtaagatctcatccagaaaacgatgaagatcgagaaggcgaagagcttaaa
aataatggcgaatcggcgatagaacaaggagaagatgaaataaatgagcagcttaatgca
aggcaaagaagacttcaaagacaaaggaagaaggaggaagagatctcgcctattccacag
gaattattgatgaaatatattcactatgcgaggacaaaaatataccctaaattgcatcag
atggatatggataaggttagcagggtatatgcggatttgagaagagaaagtatttctaca
ggttcgtttccaatcacagttcgtcatttagaatctattctaagaattgcagaatctttt
gctaaaatgagattatctgaatttgtgtcttcttatgatttggatagagctatcaaagtt
gtagttgattcctttgttgatgcccaaaaagtcagtgttcgccgccaactccgcaggtct
ttcgcaatttataccttgggtcactaa

DBGET integrated database retrieval system