KEGG   Saccharomyces cerevisiae (budding yeast): YBL023CHelp
Entry
YBL023C           CDS       T00005                                 

Gene name
MCM2
Definition
(RefSeq) MCM DNA helicase complex subunit MCM2 (EC:3.6.4.12)
  KO
K02540  
DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YBL023C (MCM2)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBL023C (MCM2)
   04113 Meiosis - yeast
    YBL023C (MCM2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YBL023C (MCM2)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YBL023C (MCM2)
Chromosome [BR:sce03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    YBL023C (MCM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(174920..177526)
Genome map
AA seq 868 aa AA seqDB search
MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPD
IDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERD
RLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREE
LTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSE
SLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDF
PTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIR
ISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKP
GEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEE
EREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVL
LLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLAD
KGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNST
LPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELK
NNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQ
MDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKV
VVDSFVDAQKVSVRRQLRRSFAIYTLGH
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatagaagacgtagacgtgaggaagatgattcggactcagaaaatgagcta
ccgccatcctcacctcagcaacattttagaggggggatgaacccagtttcatcacctatt
ggttctccagatatgattaaccctgaaggtgacgataatgaagttgacgatgtaccagat
attgatgaagttgaagaacaaatgaacgaagtagatttgatggacgataatatgtatgag
gattatgcggctgatcataatagagatagatatgatccagatcaagttgacgacagggaa
caacaagaactatctttaagcgaacgtcgccgcattgatgctcaactaaatgaaagagat
aggctattgagaaatgttgcctacatagatgacgaggacgaagaacaagaaggtgcagcg
caacttgatgaaatgggccttcctgtgcaaagacgaagaaggagaaggcagtatgaggac
ttagagaatagtgatgacgatctattgagtgacatggacattgacccattaagagaagaa
cttactttagaatctctgagtaacgttaaggctaacagttactcggaatggataacacaa
cctaatgtctcaagaactattgccagagagttaaaatcattcctgctggaatatacagat
gaaacgggtcgttctgtatatggtgcacgtattagaacattaggtgaaatgaattctgaa
tctttggaggttaattatagacacttagcggagtccaaagccatcctggcactattttta
gctaaatgtccagaagaaatgttgaaaatattcgatctcgtggctatggaggcaacagaa
ttgcattacccagattatgcccgtattcactccgaaattcacgtaagaatctctgatttt
ccaacaatatacagtttacgtgaattgcgtgagtctaatttgtcctctctagtacgcgtc
actggggtggtgacaagaagaacaggagtcttccctcaattaaaatatgtcaaattcaat
tgtttgaaatgtggctccattttgggcccattttttcaagattctaatgaagaaattaga
atctcattctgtacaaactgcaaatcaaaaggtccctttagagtcaatggagaaaaaact
gtgtaccgaaattatcaaagggttacgctccaggaagctcccggaaccgttcctccaggc
cgtctaccaagacatagagaagtcattttgttggcggatttggtagatgtatccaagcca
ggtgaagaggtagaagttaccggcatctacaaaaataactacgatggtaacttgaatgca
aagaacggattccccgtttttgcaacaattatcgaggcaaattctataaaaagaagagag
ggcaatacagctaacgaaggcgaagaagggttggatgttttcagttggactgaagaagaa
gaacgtgaatttagaaagatttctagggatcgtggtataattgataaaattatatcatcg
atggcaccgtctatctatggtcatagagatattaaaactgcagtcgcgtgctcattattt
ggaggtgttccaaaaaacgtcaatggaaaacattctattcgtggtgatatcaatgtgtta
ttattaggtgatccaggtactgccaaatctcaaatcttaaaatacgtcgagaaaacagcg
catagagcggtctttgcaactggtcagggtgcttcggctgtcggtctgacagcatccgtc
agaaaagatcctattactaaagaatggaccttagaagggggggcgctagtattggctgat
aagggtgtttgtttaattgatgaattcgataagatgaacgatcaggatcgtacatctatt
catgaggctatggaacagcaaagtatttccatttccaaggccggtattgttactacatta
caagcgcgctgctcaattattgctgcggcaaatcctaatggtggtagatataattcaacc
ttgcctttagctcagaatgttagtttgaccgagcctattctgtctagatttgatatttta
tgtgttgtcagagaccttgttgatgaagaggcagacgaaagattggccacatttgttgtc
gattctcatgtaagatctcatccagaaaacgatgaagatcgagaaggcgaagagcttaaa
aataatggcgaatcggcgatagaacaaggagaagatgaaataaatgagcagcttaatgca
aggcaaagaagacttcaaagacaaaggaagaaggaggaagagatctcgcctattccacag
gaattattgatgaaatatattcactatgcgaggacaaaaatataccctaaattgcatcag
atggatatggataaggttagcagggtatatgcggatttgagaagagaaagtatttctaca
ggttcgtttccaatcacagttcgtcatttagaatctattctaagaattgcagaatctttt
gctaaaatgagattatctgaatttgtgtcttcttatgatttggatagagctatcaaagtt
gtagttgattcctttgttgatgcccaaaaagtcagtgttcgccgccaactccgcaggtct
ttcgcaatttataccttgggtcactaa

DBGET integrated database retrieval system