KEGG   Saccharomyces cerevisiae (budding yeast): YBL027WHelp
Entry
YBL027W           CDS       T00005                                 

Gene name
RPL19B
Definition
(RefSeq) ribosomal 60S subunit protein L19B
  KO
K02885  
large subunit ribosomal protein L19e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    YBL027W (RPL19B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YBL027W (RPL19B)
  Archaea
    YBL027W (RPL19B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:join(168423..168424,168809..169376)
Genome map
AA seq 189 aa AA seqDB search
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctaacttgcgtactcaaaagagacttgccgcttctgttgtcggtgttggtaagaga
aaggtttggttagacccaaacgaaacttctgaaattgcccaagccaactctagaaatgcc
attagaaaattggtcaagaacggaaccatcgtcaagaaggccgttactgtccactctaaa
tctagaactagagcccatgctcaatccaagagagaaggtcgtcacagtggttacggtaag
agaaagggtactagagaagctcgtttaccatcccaagtcgtctggatcagaagattacgt
gtcttgagaagattattggccaagtaccgtgacgctggtaagattgacaagcatttgtac
cacgttttgtacaaggaatccaagggtaacgccttcaagcacaagagagctttggttgaa
cacattattcaagctaaggctgatgctcaacgtgaaaaggctttgaacgaagaagctgaa
gctagaagattgaagaacagagctgctcgtgacagaagagctcaaagagttgctgaaaag
agagacgctttgctaaaggaagacgcttaa

DBGET integrated database retrieval system