KEGG   Saccharomyces cerevisiae (budding yeast): YBL052CHelp
Entry
YBL052C           CDS       T00005                                 

Gene name
SAS3
Definition
Sas3p (EC:2.3.1.48)
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(119379..121874)
Genome map
AA seq 831 aa AA seqDB search
MSLTANDESPKPKKNALLKNLEIDDLIHSQFVRSDTNGHRTTRRLFNSDASISHRIRGSV
RSDKGLNKIKKGLISQQSKLASENSSQNIVNRDNKMGAVSFPIIEPNIEVSEELKVRIKY
DSIKFFNFERLISKSSVIAPLVNKNITSSGPLIGFQRRVNRLKQTWDLATENMEYPYSSD
NTPFRDNDSWQWYVPYGGTIKKMKDFSTKRTLPTWEDKIKFLTFLENSKSATYINGNVSL
CNHNETDQENEDRKKRKGKVPRIKNKVWFSQIEYIVLRNYEIKPWYTSPFPEHINQNKMV
FICEFCLKYMTSRYTFYRHQLKCLTFKPPGNEIYRDGKLSVWEIDGRENVLYCQNLCLLA
KCFINSKTLYYDVEPFIFYILTEREDTENHPYQNAAKFHFVGYFSKEKFNSNDYNLSCIL
TLPIYQRKGYGQFLMEFSYLLSRKESKFGTPEKPLSDLGLLTYRTFWKIKCAEVLLKLRD
SARRRSNNKNEDTFQQVSLNDIAKLTGMIPTDVVFGLEQLQVLYRHKTRSLSSLDDFNYI
IKIDSWNRIENIYKTWSSKNYPRVKYDKLLWEPIILGPSFGINGMMNLEPTALADEALTN
ETMAPVISNNTHIENYNNSRAHNKRRRRRRRSSEHKTSKLHVNNIIEPEVPATDFFEDTV
SSLTEYMCDYKNTNNDRLIYQAEKRVLESIHDRKGIPRSKFSTETHWELCFTIKNSETPL
GNHAARRNDTGISSLEQDEVENDVDTELYVGENAKEDEDEDEDFTLDDDIEDEQISEEND
EEEDTYEEDSDDDEDGKRKGQEQDENDIESHIRKERVRKRRKITLIEDDEE
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaacagcaaacgacgaatcgccaaaacccaaaaaaaatgcattattgaaaaac
ttagagatcgatgatctgatacattctcaatttgtcagaagcgatacaaatggacataga
actacaagacgactattcaactccgatgccagtatatcacatcgaataagaggaagtgtt
cggtctgataaaggccttaataaaataaaaaaagggttgatttcccagcagtccaaactt
gcgtcagaaaattcttctcaaaatatcgttaatagggacaataagatgggagcagtaagt
ttccccattattgaacctaatattgaagtcagcgaggagttgaaggttagaattaagtat
gattctatcaaatttttcaattttgaaagactaatatctaaatcttcagtcatagcacct
ttagttaacaaaaatataacatcatccggtcctctaatcgggtttcaaagaagagttaac
aggttaaagcaaacatgggatctagcaaccgaaaacatggagtacccatattcttctgat
aatacgccattcagggataacgattcttggcaatggtacgtaccatacggcggaacaata
aaaaaaatgaaagatttcagtacaaaaagaactttacccacctgggaagataaaataaag
tttcttacatttttagaaaactctaagtctgcaacgtacattaatggtaacgtatcactt
tgcaatcataatgaaaccgatcaagaaaacgaagataggaaaaaaaggaaagggaaagta
ccaagaatcaaaaataaagtgtggttttcccagatagaatacattgttcttcgaaattat
gaaattaaaccttggtatacatctccttttccggaacacatcaaccaaaataaaatggtt
tttatatgtgagttctgcctaaaatatatgacttctcgatatactttttatagacaccaa
ctaaagtgtctaacttttaagccccccggaaatgaaatttatcgcgacggtaagctgtct
gtttgggaaattgatgggcgggagaatgtcttgtattgtcaaaatctttgcctgttggca
aaatgttttatcaattctaagactttgtattacgatgttgaaccgtttatattctatatt
ctaacggagagagaggatacagagaaccatccctatcaaaacgcagccaaattccatttc
gtaggctatttctccaaggaaaaattcaactccaatgactataacctaagttgtatttta
actctacccatataccagaggaaaggatatggtcagtttttgatggaattttcatattta
ttatccagaaaggagtcaaaatttggaactcctgaaaaaccattgtcggatttaggatta
ttgacttacagaacgttttggaagataaaatgtgctgaagtgctattaaaattaagagac
agtgctagacgtcgatcaaataataaaaatgaagatacttttcagcaggttagcctaaac
gatatcgctaaactaacaggaatgataccaacagacgttgtgtttggattggaacaactt
caagttttgtatcgccataaaacacgctcattatccagtttggatgatttcaactatatt
attaaaatcgattcttggaacaggattgaaaatatttacaaaacttggagctcaaaaaac
tatcctcgcgtcaaatatgacaaactattgtgggaacctattatattagggccgtcattt
ggtataaatgggatgatgaacttagaacccaccgcattagcggacgaagctcttacaaat
gaaactatggctccggtaatttcgaataacacacatatagaaaactataacaacagtaga
gcacataataaacgcagaagaagaagaagaagaagtagtgagcacaaaacatccaagctt
catgtaaacaatatcatagaaccggaagtacctgctactgatttttttgaagacactgtt
tcctccttaacagagtatatgtgtgattataagaacacaaataatgatagattaatctat
caagcggaaaaaagagtgctggaaagcatccatgatcgcaaagggataccaagatcaaaa
tttagtacagaaactcattgggagctctgcttcactattaaaaactccgaaacaccactt
ggaaatcatgcagctaggagaaacgatactggaatatcaagtttagagcaggatgaagta
gaaaacgatgtagatactgaattatatgtaggtgaaaacgccaaagaagatgaagacgaa
gacgaagactttacccttgatgatgacattgaggatgagcaaatatcagaagaaaatgat
gaggaggaagacacatatgaagaagacagtgatgatgatgaggatgggaagagaaaagga
caagagcaggatgaaaacgatatagaaagccacataaggaaggagagagtcagaaaaaga
agaaaaataactctaatagaggatgacgaagaataa

DBGET integrated database retrieval system