KEGG   Saccharomyces cerevisiae (budding yeast): YBL067CHelp
Entry
YBL067C           CDS       T00005                                 

Gene name
UBP13
Definition
Ubp13p (EC:3.4.19.12 3.1.2.15)
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YBL067C (UBP13)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YBL067C (UBP13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(93639..95882)
Genome map
AA seq 747 aa AA seqDB search
MIRRWLTISKSGKKKKAVNDTITEEVEKVDFKPVNHDINDELCYSESSDNPSSSLFVSNL
DTKETFLNEDNNLQISSGLDYSSETCNQGSNYSQDGIFYISNAKAINAYGGIITQGPEAP
ILAMKVSDSMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPKKSRESDQ
PRKKEMRGKKPRIFTEASFEKSIAGTNGHLPNPKPQSVDDGKPTPVNSVNSNTAGPSEKK
SKFFKSFSAKHVQDNNKKEGSPAILTTGKPSSRPQDAPPLIVETPNEPGAPSRLSFENVT
DRPPDVPRKIIVGRVLNYENPSRGSSNSNNLDLKGESNSSLSTPLDKKDTRRSSSSSQIS
PEHRKKSALIRGPVLNIDHSLNGSDKATLYSSLRDIFECITENTYLTGVVSPSSFVDVLK
RENVLFNTTMHQDAHEFFNFLLNELSEYIERENKKIAASDINSDSEPSKSKNFISDLFQG
TLTNQIKCLTCDNITSRDEPFLDFPIEVQGDEETDIQEILKSYHQREMLNGSNKFYCDEC
CGLQEAERLVGLKQLPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSKVCQ
KYELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATA
YVLFYKAMYSNAVEKNDRENMAKEQDDNIDNLIKYDDWLRTCNSGQKKKEELPIADDLDT
AIDDSFVSNTPIKSSKKKSRMFSFRKS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaagatggctaactataagtaagtctgggaagaagaaaaaggctgttaatgat
accattacagaagaagtagaaaaggttgactttaagcctgtaaaccacgatataaatgat
gaactctgttatagcgaatcatccgataatccctctagctcattgtttgtctctaatttg
gataccaaggaaacttttttgaatgaagacaataatttgcagatttcttccggactagac
tattcttctgaaacgtgcaatcaaggcagtaattacagccaggatgggatattttatatt
tcaaacgcaaaggctataaacgcatacggaggcattatcacgcaagggcccgaggcaccc
atattagctatgaaggtgtccgactcaatgccctatggagacggctccaacaaagttttt
ggatacgaaaattttggcaatacatgttactgtaactcagttcttcaatgtctctataat
ctgtcctcattacgtgaaaatatattgcaatttccaaaaaaatcaagagaatctgatcaa
ccaagaaagaaagaaatgagaggtaagaaaccaagaatatttaccgaagcaagttttgag
aaaagcattgctggtaccaatggacatttgcctaaccctaaacctcaatctgttgatgat
ggaaagcctacccctgtaaattctgtaaattcaaatacagctgggccttcagagaagaag
agtaaattttttaaaagttttagcgcgaaacatgtacaagacaataataaaaaggaagga
agtcctgctatattaaccactggaaaaccctcttctcgtcctcaagacgcacctccattg
atagtcgaaacacctaatgagcctggtgctccgagcagattgagtttcgagaacgtcaca
gatagacctccggatgttccgcgtaaaataattgttggcagagttctcaattatgaaaat
ccttcaagaggtagcagtaatagtaataacctggacttgaaaggagaaagtaatagcagc
ttatccactccacttgataaaaaagatactagaagatctagttcctcttctcaaatatcc
ccagaacatagaaagaaatccgcacttattcgtgggccagtgctcaatattgaccatagc
ttaaacggctcagataaggctactttgtattccagtttgagagatatctttgaatgcata
actgagaatacgtatttaactggtgttgtatcgcctagctcttttgttgatgttctcaaa
agagaaaatgtattatttaatactactatgcatcaggatgctcacgaatttttcaatttc
ttattaaacgagttgagtgaatatatagaacgtgagaataaaaaaatagcagccagtgat
atcaacagcgatagcgaaccgagtaagagtaaaaatttcatcagtgacttgtttcaaggc
actttaacgaatcaaataaaatgtctgacgtgcgataacattacatctagggatgagcca
tttttggatttccccatagaagttcagggagatgaggaaacagatatacaggaaattttg
aaaagttatcaccagcgagaaatgctaaatggctcaaacaagttttattgtgacgaatgt
tgcggtttacaggaggcagagagattagttggtttgaagcaattgcctgatactttaaca
ttacacttgaaaagattcaagtattctgagaaacaaaactgtaatattaagctttttaat
aacattcactatcctctgacgctaaatgtttgctcttcaataaattctaaggtttgtcaa
aagtatgaattggctgggattgtcgttcatatgggcggtgggccacaacacggccattat
gtttccctatgtaaacatgaaaagtttggctggttgttatttgatgacgaaacggtagag
gcagttaaagaggaaacagtgttagaattcacaggtgaatctccaaatatggcaacagca
tatgttttgttttataaagcgatgtattcaaacgctgttgaaaagaatgatcgtgaaaat
atggcaaaagaacaagatgataatatagacaatctaatcaagtacgatgattggctaaga
acttgcaatagtggtcaaaagaaaaaggaagagctgcctatagcagacgatttggatact
gctatagacgacagctttgtttctaacacacccataaagtcttctaaaaaaaagtcgaga
atgtttagttttaggaaaagctga

DBGET integrated database retrieval system