KEGG   Saccharomyces cerevisiae (budding yeast): YBL097WHelp
Entry
YBL097W           CDS       T00005                                 

Gene name
BRN1
Definition
Brn1p
Orthology
K06676  
condensin complex subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBL097W (BRN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:40831..43095
Genome map
AA seq 754 aa AA seqDB search
MTTQLRYENNDDDERVEYNLFTNRSTMMANFEEWIKMATDNKINSRNSWNFALIDYFYDL
DVLKDGENNINFQKASATLDGCIKIYSSRVDSVTTETGKLLSGLAQRKTNGASNGDDSNG
GNGEGLGGDSDEANIEIDPLTGMPISNDPDVNNTRRRVYNRVLETTLVEFETIKMKELDQ
ELIIDPLFKKALVDFDEGGAKSLLLNTLNIDNTARVIFDASIKDTQNVGQGKLQRKEEEL
IERDSLVDDENEPSQSLISTRNDSTVNDSVISAPSMEDEILSLGMDFIKFDQIAVCEISG
SIEQLRNVVEDINQAKDFIENVNNRFDNFLTEEELQAAVPDNAEDDSDGFDMGMQQELCY
PDENHDNTSHDEQDDDNVNSTTGSIFEKDLMAYFDENLNRNWRGREHWKVRNFKKANLVN
KESDLLEETRTTIGDTTDKNTTDDKSMDTKKKHKQKKVLEIDFFKTDDSFEDKVFASKGR
TKIDMPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPGQKMSLFSHRKHTRGDVSSGLFEK
STVSANHSNNDIPTIADEHFWADNYERKEQEEKEKEQSKEVGDVVGGALDNPFEDDMDGV
DFNQAFEGTDDNEEASVKLDLQDDEDHKFPIRENKVTYSRVSKKVDVRRLKKNVWRSINN
LIQEHDSRKNREQSSNDSETHTEDESTKELKFSDIIQGISKMYSDDTLKDISTSFCFICL
LHLANEHGLQITHTENYNDLIVNYEDLATTQAAS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaactaaggtatgaaaataacgatgacgatgaaagagtagaatataatctc
tttaccaatagatccaccatgatggcaaattttgaagaatggatcaaaatggctacagat
aataaaatcaattcccgaaatagttggaatttcgcattgatcgactatttttatgacttg
gacgttttgaaagatggcgagaataacatcaattttcagaaagcatctgcaaccttggat
gggtgtattaagatttactcttcgagagttgattcagtgacaacggaaacaggtaagtta
ttgagcgggttggcacaaagaaagacgaatggggcatctaacggagatgacagtaacggg
ggaaatggtgaagggcttggaggtgacagtgacgaagcaaatatagagattgatccctta
actggtatgcctatatctaatgatcctgatgtgaataacactaggcggagagtgtacaac
agagttttagaaacaacattggtggagttcgaaacgatcaagatgaaagagctagaccag
gaattaataattgatccattattcaaaaaggccttggttgatttcgatgaaggtggcgcc
aagagtttattgttgaacacattaaacatagacaacactgcaagagtcattttcgatgca
tcaattaaggatacacaaaacgtagggcaaggtaaacttcaaaggaaagaagaagaatta
attgaaagagatagtttagtagatgacgaaaatgaacctagccagtcattgataagtact
cgtaatgactcaaccgtaaatgattccgttattagtgcaccttccatggaagatgagatt
ttatctcttggtatggattttataaaatttgatcaaattgcggtgtgtgaaatttcagga
tcgattgagcaactaaggaacgttgtcgaagatattaatcaagcgaaagactttatcgaa
aatgttaacaacagatttgataacttcttaactgaagaagaattgcaagcagctgtccca
gataatgcagaagatgatagcgatggctttgatatgggcatgcaacaggagctgtgctat
ccagatgaaaatcatgacaatacatcacatgatgaacaagatgatgataatgtcaacagt
accacaggaagtatattcgaaaaagatttgatggcatactttgacgaaaatctaaataga
aactggagagggagagaacattggaaagtacgaaattttaagaaagcaaacttagtgaat
aaagaatccgacctgttggaagaaacgcgaactactataggagatactactgacaaaaac
acaacggacgacaaatcgatggatacgaagaagaagcataaacaaaaaaaggttctggaa
attgatttcttcaaaacggatgatagttttgaagacaaagtctttgcctcaaaaggaagg
acaaagattgacatgccgattaagaacagaaagaacgacacacattatttactgccggat
gacttccatttttccactgatagaataacaagattgttcattaaaccggggcagaaaatg
agtctgttcagtcataggaagcataccagaggcgacgttagttcggggctttttgaaaaa
agcacagtttctgccaaccattcaaataacgacattcctactattgcagatgagcacttt
tgggcggataattacgaaaggaaagaacaagaggaaaaagaaaaggagcagtctaaagag
gttggtgatgtggtgggtggagcgctcgataatccgtttgaagatgacatggacggtgtt
gacttcaaccaagctttcgaaggaacagatgataacgaggaggccagtgtgaaacttgat
ttacaggatgacgaagatcataagttccccattcgagaaaataaagttacttattcaaga
gtttcgaaaaaagttgacgtaagaagattaaagaaaaacgtatggagatcgatcaacaat
ttgatacaagaacatgacagtaggaaaaatagagaacaaagctctaatgacagtgaaacc
cacacagaagatgaatcaacaaaggagctcaagttttctgatatcattcagggtataagt
aaaatgtattcggatgatacactaaaggacatttcaacaagcttttgttttatatgcctt
ctacacttagccaatgagcatgggttgcagataactcataccgaaaactataatgacttg
atagtgaattatgaggatctagcgacaacacaggcagcgtcatag

DBGET integrated database retrieval system