KEGG   Saccharomyces cerevisiae (budding yeast): YBL100W-AHelp
Entry
YBL100W-A         CDS       T00005                                 

Definition
gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:29935..31251
Genome map
AA seq 438 aa AA seqDB search
MESQQLHQNPHSLHGSAYASVTSKEVSSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIDSQDQHSEVPQAKTKVRNNVLPPHTLTSEENFYTW
VKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YADILTVLCKSVSKMQTNNQELKDWIALANLEYDGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTTRNYHRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSS
QYLSDDNELSLRPATERI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccaacaattacatcaaaatccacattctctacatggtagcgcctatgcttcg
gttacttctaaggaagtctcatcaaatcaagatccgttagccgtttcagcttccaattta
ccggaatttgatagagattccactaaggttaattctcaacaagagacaacacctgggaca
tcagctgttccagagaaccatcatcatgtctctcctcaacctgcttcagtaccacctcca
cagaatggacagtaccaacagcacggcatgatgactccaaacaaagctatggcttctaac
tgggcacattaccaacaaccatctatgatgacgtgttcacattatcaaacgtcacctgcg
tattatcaaccggacccacactatccgctgccacagtatatcccaccgctgagtacttcc
tcacctgatccaatcgattcacaggatcaacactctgaagtacctcaagctaagacaaag
gtgagaaataatgtcttaccaccacacactttaacatcagaagaaaacttttatacatgg
gttaaattttacatcagatttttgaagaactctaatctcggtgacatcattccaaatgat
cagggtgaaatcaaaagacaaatgacttatgaagaacatgcgtatatatacaataccttc
caagcatttgccccatttcatttattgccaacatgggtaaaacaaattttagaaattaat
tatgctgacatccttacagtcctttgtaaaagtgtgtccaaaatgcaaactaacaatcaa
gaattaaaggattggatagctcttgccaaccttgagtacgacggaagtacatctgctgat
acatttgaaattacggtcagcacgatcattcaaaggctaaaagaaaacaatatcaatgtt
agcgacagattggcctgtcaactaatacttaaaggtctatccggtgacttcaaataccta
cgtaatcaatatcgtaccaaaacgaacatgaaactttcccaattattcgctgaaattcaa
ttaatatatgacgaaaataaaatcatgaatctaaataaaccgtcccaatacaaacaacac
agcgaatacaaaaatgtttctcgcacatctccaaacacgactaacacaaaggttacaact
cgtaattatcatagaacaaatagttcaaaaccaagagcagcaaaagctcacaatattgct
acatctagtaaattctcaagggtgaacaatgatcacattaatgaatcaaccgtttcatca
caatacttaagcgatgacaacgaacttagtcttaggccagcaacagaaagaatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system