KEGG   Saccharomyces cerevisiae (budding yeast): YBL105CHelp
Entry
YBL105C           CDS       T00005                                 

Gene name
PKC1, CLY15, CLY5, CLY7, HPO2, STT1
Definition
Pkc1p (EC:2.7.11.13)
Orthology
K02677  
classical protein kinase C [EC:2.7.11.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Phosphatidylinositol signaling system
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:sce04011]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:sce04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(14241..17696)
Genome map
AA seq 1151 aa AA seqDB search
MSFSQLEQNIKKKIAVEENIIRGASALKKKTSNVMVIQKCNTNIREARQNLEYLEDSLKK
LRLKTAQQSQGENGSEDNERCNSKEYGFLSTKSPNEHIFSRLDLVKYDCPSLAQRIQYML
QQLEFKLQVEKQYQEANTKLTKLYQIDGDQRSSSAAEGGAMESKYRIQMLNKALKKYQAI
NVDFDQFKHQPNDIMDNQQPKFRRKQLTGVLTIGITAARDVDHIQSPMFARKPESYVTIK
IDDTIKARTKPSRNDRWSEDFQIPVEKGNEIEITVYDKVNDSLIPVAIMWLLLSDIAEEI
RKKKAGQTNEQQGWVNASNINGGSSLASEEGSTLTSTYSNSAIQSTSAKNVQGENTSTSQ
ISTNSWFVLEPSGQILLTLGFHKSSQIERKQLMGGLHRHGAIINRKEEIFEQHGHHFVQK
SFYNIMCCAYCGDFLRYTGFQCQDCKFLCHKKCYTNVVTKCIAKTSTDTDPDEAKLNHRI
PHRFLPTSNRGTKWCCHCGYILPWGRHKVRKCSECGIMCHAQCAHLVPDFCGMSMEMANK
ILKTIQDTKRNQEKKKRTVPSAQLGSSIGTANGSDLSPSKLAERANAPLPPQPRKHDKTP
SPQKVGRDSPTKQHDPIIDKRISLQTHGREKLNKFIDENEAYLNFTEGAQQTAEFSSPEK
TLDPTSNRRSLGLTDLSIEHSQTWESKDDLMRDELELWKAQREEMELEIKQDSGEIQEDL
EVDHIDLETKQKLDWENKNDFREADLTIDSTHTNPFRDMNSETFQIEQDHASKEVLQETV
SLAPTSTHASRTTDQQSPQKSQTSTSAKHKKRAAKRRKVSLDNFVLLKVLGKGNFGKVIL
SKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRI
YFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPE
GHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLC
QSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEE
PFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTSAPPTLTPLPSVLTTSQQEEFR
GFSFMPDDLDL
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcacaattggagcagaacattaaaaaaaagatagccgtcgaagaaaatatt
attcggggagcttctgccctcaagaaaaagactagcaatgttatggtcattcagaaatgt
aatacgaatattagagaggcacgtcaaaatcttgagtacttggaggatagcttaaaaaaa
ttacggttgaagaccgctcaacaaagtcagggtgaaaatggcagcgaagataatgagcga
tgcaattcgaaggaatacgggtttctttctaccaaatcgccaaatgaacacatattttct
cgtttggatttagtaaaatatgattgcccttctttggcgcaaagaatccaatacatgttg
caacaattagaattcaaattacaggtggaaaagcaataccaagaagccaatactaaattg
actaaattgtatcaaattgacggtgatcaacgtagtagttctgcggcagaagggggtgct
atggaatccaaatacaggattcaaatgcttaacaaagctttgaagaaataccaagctatt
aacgttgactttgatcaatttaaacaccaacccaatgacataatggataatcaacaaccg
aaattccgaagaaaacaactgactggcgttctaacaattggaataactgctgctagagat
gttgaccatatacaatcaccgatgtttgccaggaagccagagagctacgttactataaaa
atcgatgatacgatcaaagccagaacgaagccttctagaaatgacaggtggagtgaagat
tttcaaattccagttgaaaaagggaatgaaatcgagattactgtatatgataaggtgaac
gactcgctcattccagtggctataatgtggttactgctttccgatatcgctgaagaaatt
cgtaagaagaaagccggacaaacaaatgaacaacaaggatgggtcaacgcttcaaacatt
aatggtggttcttctctcgctagcgaagagggaagcacattgacttctacatactcaaac
tcagccattcagtctacttcagcaaagaatgtgcaaggcgaaaatacatcaactagtcaa
atcagtacgaattcatggtttgtcttagaaccatccgggcagattttgttaacactagga
ttccacaagtcttctcaaatagaaaggaagcagttgatgggtggactacatcgtcatggt
gctattatcaataggaaagaagagatattcgaacagcatggccaccactttgtacaaaaa
tcattttacaacattatgtgctgtgcatattgtggtgatttccttcggtatactgggttc
caatgtcaagattgtaaatttttatgtcacaaaaaatgttacaccaatgttgttactaag
tgtattgctaaaacttctactgatacggatccggacgaggcaaagttgaaccaccgtatt
cctcatagattcctgcctacttcaaaccgtggtactaaatggtgctgtcactgtggttat
attttaccatggggtagacataaagtacgcaaatgttctgaatgtggtataatgtgtcat
gctcaatgtgctcatttggttcccgatttctgtggcatgtcgatggaaatggctaataaa
attctgaaaacgattcaagacacaaaacgtaatcaagagaaaaagaagaggacagttccg
tcggcacagttggggtcatctattggtactgccaatggtagtgatctttccccatccaaa
ttagctgaaagggcaaacgctcctttgcctcctcagccaagaaaacatgataaaactcct
tcgcctcagaaggtaggaagagattctccaactaagcagcatgatcctattattgataaa
agaatttcactacaaacgcacgggcgtgagaaactaaataaatttatcgatgaaaatgag
gcctatttaaattttacagaaggtgcacaacaaaccgccgaattttcatcaccagagaaa
acactggatccaacgtcgaatagacgttccttgggactcactgatttatctattgagcat
agtcaaacttgggaatctaaagatgatttaatgagagatgaacttgaactgtggaaagca
caacgtgaggaaatggaacttgaaataaaacaagatagtggggaaatccaagaggatcta
gaagttgatcacattgatttagagaccaaacagaaactagactgggagaacaaaaatgat
ttccgtgaagctgatttgacaatagattccacacacacaaatccattccgcgatatgaat
agtgaaacctttcaaattgaacaagaccatgcttcaaaggaagtactacaagaaacagtg
tccttggctcctacaagtactcatgcctccagaaccactgatcaacaatctccgcagaaa
tcacaaaccagcacaagcgcaaagcataaaaagagagcggctaaacgtcgtaaggtttca
ttagataatttcgtattactcaaagttcttggtaaaggtaattttggtaaagttatttta
tctaaatcaaagaatactgacaggctttgtgccataaaagttctgaagaaagataatatt
attcaaaatcatgacatcgagagtgcaagagcagaaaagaaagtatttttgttagccaca
aaaactaaacacccattcttaaccaatctatactgctcttttcaaactgaaaaccgtata
tattttgctatggagtttattgggggcggtgacttaatgtggcatgttcaaaaccaaaga
ctatctgtaagaagggccaaattttatgccgccgaggtcttactggctctgaaatatttt
catgataatggtgtaatataccgtgatttgaagttggaaaacattctattaactccagaa
ggtcatataaaaattgccgattatggtttgtgtaaagatgaaatgtggtatggtaataga
acttctacattttgtggcacaccagaatttatggctccagaaattttaaaagagcaagaa
tataccaaagctgtcgattggtgggcatttggggtgctgctatatcaaatgctactgtgc
caatctccattctcaggagatgacgaagatgaagtttttaacgctatccttaccgatgaa
cccttatacccaatagatatggcaggtgagattgtacaaatattccaaggcctattaaca
aaagatcctgaaaagaggttgggtgctggtcccagggacgcagacgaagttatggaagaa
cctttcttccgtaacatcaactttgacgatatcttaaaccttcgcgtgaaaccaccctac
atcccagaaattaaatctccggaagatacatcatatttcgagcaagaattcacctctgcg
ccacccacacttacacctctgccctctgttttgacaacgagccagcaagaagagtttaga
ggattttcctttatgccagatgatttggatttatga

DBGET integrated database retrieval system