KEGG   Saccharomyces cerevisiae (budding yeast): YBR018CHelp
Entry
YBR018C           CDS       T00005                                 

Gene name
GAL7
Definition
UDP-glucose:hexose-1-phosphate uridylyltransferase (EC:2.7.7.12)
Orthology
K00965  
UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sce00052]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sce00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(274427..275527)
Genome map
AA seq 366 aa AA seqDB search
MTAEEFDFSSHSHRRYNPLTDSWILVSPHRAKRPWLGQQEAAYKPTAPLYDPKCYLCPGN
KRATGNLNPRYESTYIFPNDYAAVRLDQPILPQNDSNEDNLKNRLLKVQSVRGNCFVICF
SPNHNLTIPQMKQSDLVHIVNSWQALTDDLSREARENHKPFKYVQIFENKGTAMGCSNLH
PHGQAWCLESIPSEVSQELKSFDKYKREHNTDLFADYVKLESREKSRVVVENESFIVVVP
YWAIWPFETLVISKKKLASISQFNQMVKEDLASILKQLTIKYDNLFETSFPYSMGIHQAP
LNATGDELSNSWFHMHFYPPLLRSATVRKFLVGFELLGEPQRDLTSEQAAEKLRNLDGQI
HYLQRL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgaagaatttgatttttctagccattcccatagacgttacaatccactaacc
gattcatggatcttagtttctccacacagagctaaaagaccttggttaggtcaacaggag
gctgcttacaagcccacagctccattgtatgatccaaaatgctatctatgtcctggtaac
aaaagagctactggtaacctaaacccaagatatgaatcaacgtatattttccccaatgat
tatgctgccgttaggctcgatcaacctattttaccacagaatgattccaatgaggataat
cttaaaaataggctgcttaaagtgcaatctgtgagaggcaattgtttcgtcatatgtttt
agccccaatcataatctaaccattccacaaatgaaacaatcagatctggttcatattgtt
aattcttggcaagcattgactgacgatctctccagagaagcaagagaaaatcataagcct
ttcaaatatgtccaaatatttgaaaacaaaggtacagccatgggttgttccaacttacat
ccacatggccaagcttggtgcttagaatccatccctagtgaagtttcgcaagaattgaaa
tcttttgataaatataaacgtgaacacaatactgatttgtttgccgattacgtcaaatta
gaatcaagagagaagtcaagagtcgtagtggagaatgaatcctttattgttgttgttcca
tactgggccatctggccatttgagaccttggtcatttcaaagaagaagcttgcctcaatt
agccaatttaaccaaatggtgaaggaggacctcgcctcgattttaaagcaactaactatt
aagtatgataatttatttgaaacgagtttcccatactcaatgggtatccatcaggctcct
ttgaatgcgactggtgatgaattgagtaatagttggtttcacatgcatttctacccacct
ttactgagatcagctactgttcggaaattcttggttggttttgaattgttaggtgagcct
caaagagatttaacttcggaacaagctgctgaaaaactaagaaatttagatggtcagatt
cattatctacaaagactgtaa

DBGET integrated database retrieval system