KEGG   Saccharomyces cerevisiae (budding yeast): YBR018CHelp
Entry
YBR018C           CDS       T00005                                 

Gene name
GAL7
Definition
(RefSeq) UDP-glucose:hexose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00052  Galactose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
Module
sce_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
sce_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YBR018C (GAL7)
   00520 Amino sugar and nucleotide sugar metabolism
    YBR018C (GAL7)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     YBR018C (GAL7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GalP_UDP_tr_C GalP_UDP_transf DUF4921 HIT DcpS_C DUF3721
Motif
Other DBs
NCBI-GeneID: 852306
NCBI-ProteinID: NP_009574
SGD: S000000222
UniProt: P08431
Position
II:complement(274427..275527)
Genome map
AA seq 366 aa AA seqDB search
MTAEEFDFSSHSHRRYNPLTDSWILVSPHRAKRPWLGQQEAAYKPTAPLYDPKCYLCPGN
KRATGNLNPRYESTYIFPNDYAAVRLDQPILPQNDSNEDNLKNRLLKVQSVRGNCFVICF
SPNHNLTIPQMKQSDLVHIVNSWQALTDDLSREARENHKPFKYVQIFENKGTAMGCSNLH
PHGQAWCLESIPSEVSQELKSFDKYKREHNTDLFADYVKLESREKSRVVVENESFIVVVP
YWAIWPFETLVISKKKLASISQFNQMVKEDLASILKQLTIKYDNLFETSFPYSMGIHQAP
LNATGDELSNSWFHMHFYPPLLRSATVRKFLVGFELLGEPQRDLTSEQAAEKLRNLDGQI
HYLQRL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgaagaatttgatttttctagccattcccatagacgttacaatccactaacc
gattcatggatcttagtttctccacacagagctaaaagaccttggttaggtcaacaggag
gctgcttacaagcccacagctccattgtatgatccaaaatgctatctatgtcctggtaac
aaaagagctactggtaacctaaacccaagatatgaatcaacgtatattttccccaatgat
tatgctgccgttaggctcgatcaacctattttaccacagaatgattccaatgaggataat
cttaaaaataggctgcttaaagtgcaatctgtgagaggcaattgtttcgtcatatgtttt
agccccaatcataatctaaccattccacaaatgaaacaatcagatctggttcatattgtt
aattcttggcaagcattgactgacgatctctccagagaagcaagagaaaatcataagcct
ttcaaatatgtccaaatatttgaaaacaaaggtacagccatgggttgttccaacttacat
ccacatggccaagcttggtgcttagaatccatccctagtgaagtttcgcaagaattgaaa
tcttttgataaatataaacgtgaacacaatactgatttgtttgccgattacgtcaaatta
gaatcaagagagaagtcaagagtcgtagtggagaatgaatcctttattgttgttgttcca
tactgggccatctggccatttgagaccttggtcatttcaaagaagaagcttgcctcaatt
agccaatttaaccaaatggtgaaggaggacctcgcctcgattttaaagcaactaactatt
aagtatgataatttatttgaaacgagtttcccatactcaatgggtatccatcaggctcct
ttgaatgcgactggtgatgaattgagtaatagttggtttcacatgcatttctacccacct
ttactgagatcagctactgttcggaaattcttggttggttttgaattgttaggtgagcct
caaagagatttaacttcggaacaagctgctgaaaaactaagaaatttagatggtcagatt
cattatctacaaagactgtaa

DBGET integrated database retrieval system