KEGG   Saccharomyces cerevisiae (budding yeast): YBR019CHelp
Entry
YBR019C           CDS       T00005                                 

Gene name
GAL10
Definition
bifunctional UDP-glucose 4-epimerase/aldose 1-epimerase (EC:5.1.3.2 5.1.3.3)
Orthology
K01784  
UDP-glucose 4-epimerase [EC:5.1.3.2]
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBR019C (GAL10)
   00052 Galactose metabolism
    YBR019C (GAL10)
   00520 Amino sugar and nucleotide sugar metabolism
    YBR019C (GAL10)
Enzymes [BR:sce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     YBR019C (GAL10)
    5.1.3.3  aldose 1-epimerase
     YBR019C (GAL10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(276253..278352)
Genome map
AA seq 699 aa AA seqDB search
MTAQLQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTK
HHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLE
LMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGHTKYAIENILNDLYNS
DKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSR
DGTPIRDYIHVVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASG
IDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTENPFGYQLRGV
EARFSAEDMRYDARFVTIGAGTRFQATFANLGASIVDLKVNGQSVVLGYENEEGYLNPDS
AYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKD
VFTAEYMLIDNEKDTEFPGDLLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYF
NLNKPYGDTIEGTEIMVRSKKSVDVDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQFDC
CFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTGDFLSAGYEARQ
GFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcagttacaaagtgaaagtacttctaaaattgttttggttacaggtggtgct
ggatacattggttcacacactgtggtagagctaattgagaatggatatgactgtgttgtt
gctgataacctgtcgaattcaacttatgattctgtagccaggttagaggtcttgaccaag
catcacattcccttctatgaggttgatttgtgtgaccgaaaaggtctggaaaaggttttc
aaagaatataaaattgattcggtaattcactttgctggtttaaaggctgtaggtgaatct
acacaaatcccgctgagatactatcacaataacattttgggaactgtcgttttattagag
ttaatgcaacaatacaacgtttccaaatttgttttttcatcttctgctactgtctatggt
gatgctacgagattcccaaatatgattcctatcccagaagaatgtcccttagggcctact
aatccgtatggtcatacgaaatacgccattgagaatatcttgaatgatctttacaatagc
gacaaaaaaagttggaagtttgctatcttgcgttattttaacccaattggcgcacatccc
tctggattaatcggagaagatccgctaggtataccaaacaatttgttgccatatatggct
caagtagctgttggtaggcgcgagaagctttacatcttcggagacgattatgattccaga
gatggtaccccgatcagggattatatccacgtagttgatctagcaaaaggtcatattgca
gccctgcaatacctagaggcctacaatgaaaatgaaggtttgtgtcgtgagtggaacttg
ggttccggtaaaggttctacagtttttgaagtttatcatgcattctgcaaagcttctggt
attgatcttccatacaaagttacgggcagaagagcaggtgatgttttgaacttgacggct
aaaccagatagggccaaacgcgaactgaaatggcagaccgagttgcaggttgaagactcc
tgcaaggatttatggaaatggactactgagaatccttttggttaccagttaaggggtgtc
gaggccagattttccgctgaagatatgcgttatgacgcaagatttgtgactattggtgcc
ggcaccagatttcaagccacgtttgccaatttgggcgccagcattgttgacctgaaagtg
aacggacaatcagttgttcttggctatgaaaatgaggaagggtatttgaatcctgatagt
gcttatataggcgccacgatcggcaggtatgctaatcgtatttcgaagggtaagtttagt
ttatgcaacaaagactatcagttaaccgttaataacggcgttaatgcgaatcatagtagt
atcggttctttccacagaaaaagatttttgggacccatcattcaaaatccttcaaaggat
gtttttaccgccgagtacatgctgatagataatgagaaggacaccgaatttccaggtgat
ctattggtaaccatacagtatactgtgaacgttgcccaaaaaagtttggaaatggtatat
aaaggtaaattgactgctggtgaagcgacgccaataaatttaacaaatcatagttatttc
aatctgaacaagccatatggagacactattgagggtacggagattatggtgcgttcaaaa
aaatctgttgatgtcgacaaaaacatgattcctacgggtaatatcgtcgatagagaaatt
gctacctttaactctacaaagccaacggtcttaggccccaaaaatccccagtttgattgt
tgttttgtggtggatgaaaatgctaagccaagtcaaatcaatactctaaacaatgaattg
acgcttattgtcaaggcttttcatcccgattccaatattacattagaagttttaagtaca
gagccaacttatcaattttataccggtgatttcttgtctgctggttacgaagcaagacaa
ggttttgcaattgagcctggtagatacattgatgctatcaatcaagagaactggaaagat
tgtgtaaccttgaaaaacggtgaaacttacgggtccaagattgtctacagattttcctga

DBGET integrated database retrieval system