KEGG   Saccharomyces cerevisiae (budding yeast): YBR020WHelp
Entry
YBR020W           CDS       T00005                                 

Gene name
GAL1
Definition
galactokinase (EC:2.7.1.6)
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YBR020W (GAL1)
   00520 Amino sugar and nucleotide sugar metabolism
    YBR020W (GAL1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     YBR020W (GAL1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YBR020W (GAL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:279021..280607
Genome map
AA seq 528 aa AA seqDB search
MTKSHSEEVIVPEFNSSAKELPRPLAEKCPSIIKKFISAYDAKPDFVARSPGRVNLIGEH
IDYCDFSVLPLAIDFDMLCAVKVLNEKNPSITLINADPKFAQRKFDLPLDGSYVTIDPSV
SDWSNYFKCGLHVAHSFLKKLAPERFASAPLAGLQVFCEGDVPTGSGLSSSAAFICAVAL
AVVKANMGPGYHMSKQNLMRITVVAEHYVGVNNGGMDQAASVCGEEDHALYVEFKPQLKA
TPFKFPQLKNHEISFVIANTLVVSNKFETAPTNYNLRVVEVTTAANVLAATYGVVLLSGK
EGSSTNKGNLRDFMNVYYARYHNISTPWNGDIESGIERLTKMLVLVEESLANKKQGFSVD
DVAQSLNCSREEFTRDYLTTSPVRFQVLKLYQRAKHVYSESLRVLKAVKLMTTASFTADE
DFFKQFGALMNESQASCDKLYECSCPEIDKICSIALSNGSYGSRLTGAGWGGCTVHLVPG
GPNGNIEKVKEALANEFYKVKYPKITDAELENAIIVSKPALGSCLYEL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatctcattcagaagaagtgattgtacctgagttcaattctagcgcaaaggaa
ttaccaagaccattggccgaaaagtgcccgagcataattaagaaatttataagcgcttat
gatgctaaaccggattttgttgctagatcgcctggtagagtcaatctaattggtgaacat
attgattattgtgacttctcggttttacctttagctattgattttgatatgctttgcgcc
gtcaaagttttgaacgagaaaaatccatccattaccttaataaatgctgatcccaaattt
gctcaaaggaagttcgatttgccgttggacggttcttatgtcacaattgatccttctgtg
tcggactggtctaattactttaaatgtggtctccatgttgctcactcttttctaaagaaa
cttgcaccggaaaggtttgccagtgctcctctggccgggctgcaagtcttctgtgagggt
gatgtaccaactggcagtggattgtcttcttcggccgcattcatttgtgccgttgcttta
gctgttgttaaagcgaatatgggccctggttatcatatgtccaagcaaaatttaatgcgt
attacggtcgttgcagaacattatgttggtgttaacaatggcggtatggatcaggctgcc
tctgtttgcggtgaggaagatcatgctctatacgttgagttcaaaccgcagttgaaggct
actccgtttaaatttccgcaattaaaaaaccatgaaattagctttgttattgcgaacacc
cttgttgtatctaacaagtttgaaaccgccccaaccaactataatttaagagtggtagaa
gtcactacagctgcaaatgttttagctgccacgtacggtgttgttttactttctggaaaa
gaaggatcgagcacgaataaaggtaatctaagagatttcatgaacgtttattatgccaga
tatcacaacatttccacaccctggaacggcgatattgaatccggcatcgaacggttaaca
aagatgctagtactagttgaagagtctctcgccaataagaaacagggctttagtgttgac
gatgtcgcacaatccttgaattgttctcgcgaagaattcacaagagactacttaacaaca
tctccagtgagatttcaagtcttaaagctatatcagagggctaagcatgtgtattctgaa
tctttaagagtcttgaaggctgtgaaattaatgactacagcgagctttactgccgacgaa
gactttttcaagcaatttggtgccttgatgaacgagtctcaagcttcttgcgataaactt
tacgaatgttcttgtccagagattgacaaaatttgttccattgctttgtcaaatggatca
tatggttcccgtttgaccggagctggctggggtggttgtactgttcacttggttccaggg
ggcccaaatggcaacatagaaaaggtaaaagaagcccttgccaatgagttctacaaggtc
aagtaccctaagatcactgatgctgagctagaaaatgctatcatcgtctctaaaccagca
ttgggcagctgtctatatgaattataa

DBGET integrated database retrieval system