KEGG   Saccharomyces cerevisiae (budding yeast): YBR056W-AHelp
Entry
YBR056W-A         CDS       T00005                                 

Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:351255..351455
Genome map
AA seq 66 aa AA seqDB search
MRHQYYQPQPMYYQPQPQPIYIQQGPPPPRNDCCCCCNCGDCCSAIANVLCCLCLIDLCC
SCAGGM
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgagacatcaatactatcaaccacaaccgatgtattatcaaccacaaccgcaacctata
tacatacaacaagggccgccgccaccaagaaatgattgttgttgttgttgtaactgtggc
gattgctgttcagcaattgcgaacgttttatgttgtctgtgtctaattgatctatgttgt
agctgcgctggcggcatgtaa

DBGET integrated database retrieval system