KEGG   Saccharomyces cerevisiae (budding yeast): YBR058CHelp
Entry
YBR058C           CDS       T00005                                 

Gene name
UBP14, GID6
Definition
Ubp14p (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YBR058C (UBP14)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YBR058C (UBP14)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YBR058C (UBP14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(353672..356017)
Genome map
AA seq 781 aa AA seqDB search
MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH
IRVTEYACDTIHSNYLTIAKVEKPKQENVEENNNNKKIKLQVIETSEDDTHNTIWSLQRF
NGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQIP
SKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIK
LGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENW
QFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL
DVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEFLT
FLLDLLDKKFFSSSSSGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDE
PQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIPVKT
SNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQCSISQLIEMGFT
QNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEVSLTSMLS
MGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFPEPEVPNEEQQQKKDLGYSTAKPY
ALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIEDMKKNGYIYFYTR
C
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcagtactagaaaacgttaacgttcctgcagtcgtttcaaaagatgagtgt
atttattgctttgaatccccttataatgaaccattggccctcaatgcatcacctaaacat
tcattgaatatatgcttaaactgtttccaagctacgtgcaacagacatgttccactccat
atccgagtcacagaatatgcttgcgataccatacattccaattatttaactattgctaaa
gtggagaaacctaagcaagaaaatgtagaagaaaataataacaacaaaaaaataaagcta
caggtaattgagacgtcagaagacgacacccacaacactatttggagtttacaaaggttc
aatggtgaaaatgttcccaggaccgtactttcgaagtcgacagactctgacatttcttct
acggccttggagaagattgaaaagatattaaaggcgaagtcacaagacttcgaggataag
aagaactcctgggtgttagaaatcagcacctgtccacatacagaaaactttcaaattcca
tctaagcccgaaaatactgtgaatttaaaccaatgctcttcctgtgatttgactcaaaat
ctctggttatgcctacattgtggtaatatcggatgtggcagggaacaaatcgggattgat
ggtcactcgcatgctttggatcattatcggagtaataataatcacccattagctatcaaa
ttagggtctttaagctcttcaacctatgatctgtattgttacgcatgtgacgacgaaact
agatttccagataatgttaatttaggcagtgcactacaaatatacggaattaacatacaa
gaaaagattgcggatgaaaagactctagttcaattacaagtggaacagaacgaaaattgg
caatttagaatggtcgattctagcggtaaagaatttgaaaaattatccgctagtaagaat
tatggctgtggtctgatcaatttgggtaattcctgttacttaaattcggttatacaaagc
ttggtgaatggtggcgtcccgaattggtccttggattttctaggaagtaaatttccactg
gatgttgtatatccggacaataatttaaagtgccaatggatcaagctactcaatgccatg
aaatgtgaacccgaactatatccaaatggtatcaaacctactactttcaagaaatgcatt
gggcaaaatcatcaggaattcagttccaatagacaacaggatgcgatggaatttctaacc
ttccttttagacttgttagacaagaaatttttttcaagtagttcttcaggtattccaaat
cccaacgatttagttagatttatgatggaggataggctccaatgtaacatttgcgggaag
gttaaatattcttatgaacccacagaggctatacagattcccttagaggagaatgatgaa
cctcaagatatgttagagagaatcaaggcgtattttgaagggcagacgattgaatttaaa
tgtgctaattgtaaggaaaaggttaccgcaaataaaaaacctggtttcaaatctcttcct
caaacacttattttgaacccaataaggattagattacagaactggattcctgttaagaca
agtaatgagctttctttaccaggtttaatagacagggatgatatgctagatgtttcgtct
tatttatcacaaggatttgatcctcaaactgaaaacttattgcctgatgaggacgaaaac
cgtagctcttttacgccaaaccaatgcagtatttctcaattaattgaaatgggctttact
caaaatgctagcgtgcgcgccctatttaacaccggaaaccaagacgctgagagcgctatg
aattggctattccagcatatggatgaccctgatttaaatgatccctttgtcccgcctcct
aatgtccccaagaaagataagagagaagtggatgaggtatcattgacttcaatgttatcc
atgggactaaatcccaacttatgtcgtaaagccttgatactcaacaacggagatgttaat
cgtagtgttgaatgggtatttaacaacatggatgatgatggaacatttcccgaacctgaa
gtgccaaatgaagaacagcaacaaaaaaaggatcttggatattcgaccgctaaaccgtac
gctttaactgcagttatttgtcataagggaaattctgtccattctggtcactatgttgtt
tttattcgtaaactagtggcagacaaatggaagtgggttctttataacgatgagaaacta
gttgctgccgacagcattgaagatatgaaaaaaaatggttatatttatttctatacaaga
tgctaa

DBGET integrated database retrieval system