KEGG   Saccharomyces cerevisiae (budding yeast): YBR060CHelp
Entry
YBR060C           CDS       T00005                                 

Gene name
ORC2, RRR1, SIR5
Definition
origin recognition complex subunit 2
Orthology
K02604  
origin recognition complex subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR060C (ORC2)
   04113 Meiosis - yeast
    YBR060C (ORC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(360652..362514)
Genome map
AA seq 620 aa AA seqDB search
MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNT
SPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEES
KTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSL
TTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL
DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKM
FPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPC
LILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKL
ILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI
SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLS
ANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEII
WVPYTYAELEKLLKTVLNTL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatggggaagactttgtagagcataatgatatcctatcgtctccggcaaaaagc
aggaatgtaaccccaaaaagggttgacccacatggagaaagacaactgagaagaattcat
tcatcaaagaagaatttgttggaaagaatctcgcttgtaggcaacgaaaggaaaaataca
tctccagatccggcactcaaacctaaaacgccaagtaaagctccccgtaaacgtggaaga
ccaagaaagatacaggaagaattaactgataggatcaagaaggatgagaaagatacaatt
tcctctaagaaaaagaggaaattggacaaagatacatcaggtaatgtcaatgaggaaagc
aagacttctaacaacaagcaggtgatggaaaagacggggataaaagagaaaagagaacgc
gaaaaaatacaggtagcgaccacaacatatgaagataatgtgactccacaaactgatgat
aattttgtatcaaattcacccgagccaccagaacctgcaacaccatctaagaagtcttta
accactaatcatgattttacttcgcccctaaagcaaattataatgaataatttaaaagaa
tataaagactcaacctccccaggtaaattaaccttgagtagaaattttactccaacccct
gtaccgaaaaataaaaagctctaccaaacttcggaaaccaagtcagcaagctcgtttttg
gatacttttgaaggatatttcgaccaaagaaaaattgtcagaactaatgcgaagtcaagg
cacaccatgtcaatggcacctgacgttaccagagaagagttttccctagtatcaaacttt
ttcaacgaaaattttcaaaaacgtcccaggcaaaagttatttgaaattcagaaaaaaatg
tttccccagtattggtttgaattgactcaaggattctccttattattttatggtgtaggt
tcgaaacgtaattttttggaagagtttgccattgactacttgtctccgaaaatcgcgtac
tcgcaactggcttatgagaatgaattacaacaaaacaaacctgtaaattccatcccatgc
cttattttaaatggttacaaccctagctgtaactatcgtgacgtcttcaaagagattacc
gatcttttggtccccgctgagttgacaagaagcgaaactaagtactggggcaatcatgtg
attttgcagatccaaaagatgattgatttctacaaaaatcaacctttagatatcaaatta
atacttgtagtgcataatctggatggtcctagcataaggaaaaacacttttcagacgatg
ctaagcttcctctccgtcatcagacaaatcgccatagtcgcctctacagaccacatttac
gctccgctcctctgggacaacatgaaggcccaaaactacaactttgtctttcatgatatt
tcgaattttgaaccgtcgacagtcgagtctacgttccaagatgtgatgaagatgggtaaa
agcgataccagcagtggtgctgaaggtgcgaaatacgtcttacaatcacttactgtgaac
tccaagaagatgtataagttgcttattgaaacacaaatgcagaatatggggaatctatcc
gctaacacaggtcctaagcgtggtactcaaagaactggagtagaacttaaacttttcaac
catctctgtgccgctgattttattgcttctaatgagatagctctaaggtcgatgcttaga
gaattcatagaacataaaatggccaacataactaagaacaattctggaatggaaattatt
tgggtaccctacacgtatgcggaacttgaaaaacttctgaaaaccgttttaaatactcta
taa

DBGET integrated database retrieval system