KEGG   Saccharomyces cerevisiae (budding yeast): YBR072WHelp
Entry
YBR072W           CDS       T00005                                 

Gene name
HSP26
Definition
Hsp26p
Orthology
K13993  
HSP20 family protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YBR072W (HSP26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:382030..382674
Genome map
AA seq 214 aa AA seqDB search
MSFNSPFFDFFDNINNEVDAFNRLLGEGGLRGYAPRRQLANTPAKDSTGKEVARPNNYAG
ALYDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDID
IEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYA
NGVLTLTVPKLKPQKDGKNHVKKIEVSSQESWGN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaacagtccattttttgatttctttgacaacatcaacaacgaagttgatgcc
tttaacagattgctgggtgaaggcggcttaagaggctacgcaccaagacgtcagttagca
aacacacccgcaaaggattctactggcaaggaagttgctagaccaaataactatgctggc
gctctttatgatcccagagatgaaaccttagatgattggttcgacaatgacttgtccctg
ttcccatctggtttcggtttccctagaagtgtcgcagttccagttgatattttggaccat
gacaacaactacgagttgaaagtcgtggttcctggtgtcaaaagcaagaaggacattgat
attgagtaccatcaaaacaagaaccaaattttggtttctggtgaaattccatctaccttg
aatgaagagagtaaagacaaggtcaaggtcaaggagagcagctctggtaagttcaagaga
gtcatcactttgccagactacccaggtgtggatgcagacaacattaaagcagactacgca
aatggtgttttgacattaacagttccaaaattgaagcctcagaaggatggtaagaaccac
gtcaagaagattgaggtttcttctcaagaatcgtggggtaactaa

DBGET integrated database retrieval system