KEGG   Saccharomyces cerevisiae (budding yeast): YBR073WHelp
Entry
YBR073W           CDS       T00005                                 

Gene name
RDH54, TID1
Definition
DNA-dependent ATPase RDH54 (EC:5.99.1.- 3.6.4.12 3.6.1.-)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YBR073W (RDH54)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     YBR073W (RDH54)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:383112..385988
Genome map
AA seq 958 aa AA seqDB search
MAVISVKPRRREKILQEVKNSSVYQTVFDSGTTQMQIPKYENKPFKPPRRVGSNKYTQLK
PTATAVTTAPISKAKVTVNLKRSISAGPTLNLAKKPNNLSSNENTRYFTIMYRKPTTKKH
KTWSGDGYATLKASSDKLCFYNEAGKFLGSSMLPSDSDSLFETLFKAGSNEVQLDYELKE
NAEIRSAKEALSQNMGNPSPPTTSTTETVPSTKNDGGKYQMPLSQLFSLNTVKRFKSVTK
QTNEHMTTVPKTSQNSKAKKYYPVFDVNKIDNPIVMNKNAAAEVDVIVDPLLGKFLRPHQ
REGVKFMYDCLMGLARPTIENPDIDCTTKSLVLENDSDISGCLLADDMGLGKTLMSITLI
WTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWKREFGKWLNLSRIGVLTLS
SRNSPDMDKMAVRNFLKVQRTYQVLIIGYEKLLSVSEELEKNKHLIDMLVCDEGHRLKNG
ASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTIIDFINPGILGSFASFKRRFIIPITRA
RDTANRYNEELLEKGEERSKEMIEITKRFILRRTNAILEKYLPPKTDIILFCKPYSQQIL
AFKDILQGARLDFGQLTFSSSLGLITLLKKVCNSPGLVGSDPYYKSHIKDTQSQDSYSRS
LNSGKLKVLMTLLEGIRKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQR
DSIVTSFNRNPAIFGFLLSAKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQK
KPCFIYRLVTTGCIDEKILQRQLMKNSLSQKFLGDSEMRNKESSNDDLFNKEDLKDLFSV
HTDTKSNTHDLICSCDGLGEEIEYPETNQQQNTVELRKRSTTTWTSALDLQKKMNEAATN
DDAKKSQYIRQCLVHYKHIDPARQDELFDEVITDSFTELKDSITFAFVKPGEICLREQ
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaataagcgttaaacctcgacgaagagagaagatcctacaggaggtaaaaaac
agctcggtatatcaaacggtatttgattccggtactactcaaatgcagataccgaaatat
gagaacaagccattcaagcctccaagaagggttggatcaaataagtacacacaactcaaa
ccaaccgccactgcagtcacaacagcccctatatctaaagccaaagttactgtcaacttg
aaaagaagcatttcggcgggacctactttaaatcttgccaagaagccgaataatctgtcc
tcaaatgaaaacactagatattttactatcatgtacaggaagcctactaccaaaaagcac
aagacttggagtggtgatggctacgctaccttaaaagccagtagcgataagttatgcttt
tataacgaagcagggaaatttcttgggtcaagtatgctaccaagtgattcagattctctc
ttcgaaactcttttcaaagcaggctccaatgaagtacaattggattacgaattgaaggaa
aatgcagaaatacgtagcgccaaagaagccttatcacaaaacatgggaaatcccagccca
ccgaccacaagcacaacagaaacagtgccttctacgaagaatgacggtggcaaataccaa
atgcctctgtctcagctgttttcactaaacactgtgaaaagattcaaatcagtaacaaag
caaacaaatgaacacatgaccacagtacctaaaaccagtcaaaattccaaagccaaaaaa
tattatccagtatttgatgtcaacaaaatcgataatcctatagtaatgaacaaaaatgca
gccgctgaagttgacgtaattgttgatccattactgggcaaattcttgcgccctcatcag
agggaaggggtgaagttcatgtatgattgcttaatgggcttggcaagaccaactattgaa
aatccggatatcgattgtactactaaaagtttagtgttagaaaatgactcagatattagt
ggatgccttttggctgatgatatgggtttaggtaaaacactaatgagtataactttgatt
tggacattaattaggcaaactccttttgcatcaaaagtttcatgttcgcaatcaggcata
ccattaactggactttgtaagaagattttagtcgtttgtcccgttactttaataggaaat
tggaaaagagaatttggaaaatggttaaatttgtcaagaataggtgttttgacattaagc
tcaaggaattctcctgatatggataaaatggctgtcagaaattttttaaaagtgcaacga
acttatcaagtcttgattattggctacgaaaaactcttgagtgtttctgaagaattagag
aaaaataaacatttgattgacatgctggtgtgtgacgaaggccatcgactaaaaaacggg
gcttctaaaattttaaatacgctgaagagtttagacataagaaggaagcttttgcttacg
ggaactcctatacaaaatgatcttaatgagtttttcactattatagatttcataaaccca
ggaatccttggaagcttcgcttctttcaaaagaagattcattatccctataactagagcc
agagacactgcaaacagatacaacgaagaattgttggaaaagggggaagaaaggtcaaaa
gagatgatagaaattacgaaaagatttattttgagacgaacaaatgcgattttagaaaag
taccttcctccaaagacggatataattttattctgtaaaccatacagccaacagatattg
gcattcaaagatattttgcagggcgcacgtttagattttggacaattgacgttcagttct
tcgctaggactaataacattactgaaaaaggtttgtaactctcctggattggttggctca
gatccctattacaaatcacatataaaggatacccaatctcaggacagctatagtcgttct
ttgaactctggtaagttaaaggtattaatgacattactagaaggtattaggaagggtacc
aaggagaaggtcgtcgtagtgtctaactacactcaaacattggatataattgaaaatttg
atgaatatggctgggatgtcacattgcagactcgacggttccatacctgctaaacaaagg
gactctatcgtcacatctttcaatcggaatccagccatatttggattcttgttgagtgca
aaatcgggaggtgtaggattgaatctagtcggtgcttcgcgacttattttatttgataat
gattggaatccttcagtagatttgcaagcgatgtcacgaattcatagagatggtcaaaaa
aagccgtgcttcatatatagacttgtcacaactgggtgtatcgatgagaaaatattgcaa
aggcaattaatgaagaacagtttgagccaaaaatttctaggtgactcggagatgagaaat
aaagaatcttctaatgatgatcttttcaataaagaggacttgaaggacctgttttctgtc
catacagataccaagagtaacacacatgacttaatttgttcttgcgatggtttaggtgag
gaaattgaatatcctgaaacaaatcaacagcagaacaccgtagagctgagaaagcgtagc
actacgacatggacaagtgcgctggatttacaaaagaaaatgaatgaagcagccaccaac
gatgatgccaaaaagtcacaatacattaggcaatgtctcgttcattataagcatatcgat
ccagcaagacaagatgaattatttgatgaggttatcacagattcgttcaccgaattgaaa
gatagtattacctttgcgtttgtaaagcccggcgagatatgtctcagagaacaatga

DBGET integrated database retrieval system