KEGG   Saccharomyces cerevisiae (budding yeast): YBR093CHelp
Entry
YBR093C           CDS       T00005                                 

Gene name
PHO5
Definition
Pho5p (EC:3.1.3.2)
Orthology
K01078  
acid phosphatase [EC:3.1.3.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Riboflavin metabolism
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    YBR093C (PHO5)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR093C (PHO5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     YBR093C (PHO5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(429548..430951)
Genome map
AA seq 467 aa AA seqDB search
MFKSVVYSILAASLANAGTIPLGKLADVDKIGTQKDIFPFLGGAGPYYSFPGDYGISRDL
PEGCEMKQLQMVGRHGERYPTVSLAKTIKSTWYKLSNYTRQFNGSLSFLNDDYEFFIRDD
DDLEMETTFANSDDVLNPYTGEMNAKRHARDFLAQYGYMVENQTSFAVFTSNSKRCHDTA
QYFIDGLGDQFNITLQTVSEAESAGANTLSACNSCPAWDYDANDDIVNEYDTTYLDDIAK
RLNKENKGLNLTSTDASTLFSWCAFEVNAKGYSDVCDIFTKDELVHYSYYQDLHTYYHEG
PGYDIIKSVGSNLFNASVKLLKQSEIQDQKVWLSFTHDTDILNFLTTAGIIDDKNNLTAE
YVPFMGNTFHRSWYVPQGARVYTEKFQCSNDTYVRYVINDAVVPIETCSTGPGFSCEIND
FYDYAEKRVAGTDFLKVCNVSSVSNSTELTFYWDWNTTHYNASLLRQ
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatctgttgtttattcaattttagccgcttctttggccaatgcaggtaccatt
cccttaggcaaactagccgatgtcgacaagattggtacccaaaaagatatcttcccattt
ttgggtggtgccggaccatactactctttccctggcgactatggtatttctcgtgatttg
cctgaaggttgtgaaatgaagcaactgcaaatggttggtagacatggtgaaagataccct
actgtcagtctggctaagactatcaagagtacatggtataagttgagcaattacactcgt
caattcaacggctcattgtcattcttgaacgatgattacgagtttttcatccgtgatgac
gatgatttggaaatggaaaccacttttgccaactcggacgatgttttgaacccatacact
ggtgaaatgaacgccaagagacatgctcgtgacttcttggctcaatacggttacatggtc
gaaaaccaaaccagtttcgccgtttttacctctaattctaagagatgtcatgacactgct
caatatttcattgatggtttaggtgaccaattcaacatcaccttgcagactgtcagtgaa
gctgaatccgctggtgccaacactttgagtgcttgtaactcatgtcctgcttgggactac
gatgccaatgatgacattgtaaatgaatacgacacaacctacttggatgacattgccaag
agattgaacaaggaaaacaagggtttgaacttgacctcaactgacgctagtactttattc
tcgtggtgtgcatttgaagtgaacgctaaaggttacagtgatgtctgtgatattttcacc
aaggatgaattagtccattactcctactaccaagacttgcacacttattaccatgagggt
ccaggttacgacattatcaagtctgtcggttccaacttgttcaatgcctcagtcaaatta
ttaaagcaaagtgagattcaagaccaaaaggtttggttgagttttacccacgataccgat
atcctaaactttttgaccaccgctggtataattgacgacaaaaacaacttaactgccgaa
tacgttccattcatgggcaacactttccacagatcctggtacgttcctcaaggtgctcgt
gtctacaccgaaaaattccaatgttctaacgacacctacgtcagatacgtcattaacgat
gctgttgttccaattgaaacctgttccactggtccagggttctcttgtgaaatcaatgac
ttctacgactatgctgaaaagagagtagccggtactgacttcctaaaggtctgtaacgtc
agcagcgtcagtaactctactgaattgaccttctactgggactggaacactactcattac
aacgccagtctattgagacaatag

DBGET integrated database retrieval system