KEGG   Saccharomyces cerevisiae (budding yeast): YBR112CHelp
Entry
YBR112C           CDS       T00005                                 

Gene name
CYC8, CRT8, SSN6
Definition
Cyc8p
Orthology
K06665  
glucose repression mediator protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR112C (CYC8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(462870..465770)
Genome map
AA seq 966 aa AA seqDB search
MNPGGEQTIMEQPAQQQQQQQQQQQQQQQQAAVPQQPLDPLTQSTAETWLSIASLAETLG
DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL
GHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELD
PHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEW
QGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWY
HLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN
PYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQLENPGNINK
SNGAPTNASPAPPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQQHPAQQTPINSS
ATMYSNGASPQLQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQA
QAQAQAQAQAQAQAQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQPLPRQQLQQKG
VSVQMLNPQQGQPYITQPTVIQAHQLQPFSTQAMEHPQSSQLPPQQQQLQSVQHPQQLQG
QPQAQAPQPLIQHNVEQNVLPQKRYMEGAIHTLVDAAVSSSTHTENNTKSPRQPTHAIPT
QAPATGITNAEPQVKKQKLNSPNSNINKLVNTATSIEENAKSEVSNQSPAVVESNTNNTS
QEEKPVKANSIPSVIGAQEPPQEASPAEEATKAASVSPSTKPLNTEPESSSVQPTVSSES
STTKANDQSTAETIELSTATVPAEASPVEDEVRQHSKEENGTTEASAPSTEEAEPAASRD
AEKQQDETAATTITVIKPTLETMETVKEEAKMREEEQTSQEKSPQENTLPRENVVRQVEE
DENYDD
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgggcggtgaacaaacaataatggaacaacccgctcaacagcaacaacaacag
caacaacaacagcagcaacagcaacagcaggcagcagttcctcagcagccactcgaccca
ttaacacaatcaactgcggaaacttggctctccattgcttctttggcagaaacccttggt
gatggcgacagggccgcaatggcatatgacgccactttacagttcaatccctcatctgca
aaggctttaacatctttggctcacttgtaccgttccagagacatgttccaaagagctgca
gaattatatgaaagagcacttttggtaaatcccgaactatcagatgtgtgggctacttta
ggtcattgttatctgatgctggatgatctgcaaagagcttacaatgcctatcaacaggct
ctctaccacctcagtaatcccaacgtaccgaaattatggcatggaatcggcattctttat
gacagatatggttcgctcgactatgccgaagaagcttttgccaaagttttggaattggac
cctcattttgaaaaggcaaacgaaatttacttcagactaggtattatttataaacatcag
ggtaaatggtctcaagctttggaatgcttcagatacattctccctcaacctcctgctccc
ttgcaggagtgggacatatggtttcagttgggtagtgttttggagagtatgggagagtgg
caaggtgcgaaggaagcctacgagcatgtcttggctcaaaatcaacatcatgccaaagta
ttacaacaattaggttgtctttacggtatgagtaacgtacaattttatgaccctcaaaag
gcattggattatcttctaaagtcgttagaagcagatccctccgatgccactacatggtac
catctcggtagagtgcatatgattagaacagattatactgccgcatatgatgctttccaa
caagctgttaatagagattcaagaaaccctatcttttggtgctcaatcggtgttttatat
taccaaatttctcaatacagagacgccttagacgcgtacacaagagccataagattaaat
ccttatattagtgaagtttggtacgatctaggtactctttacgaaacttgtaacaaccaa
ttatctgacgcccttgatgcgtataagcaagctgcaagactggacgtaaataatgttcac
ataagagaaagattagaagctttaacaaagcagttagaaaacccaggcaatataaacaaa
tcgaacggtgcgccaacgaatgcctctcctgccccacctcctgtgattttacaacctacc
ttacaacctaatgatcaaggaaatcctttgaacactagaatttcagcccaatctgccaat
gctactgcttcaatggtacaacaacagcatcctgctcaacaaacgcctattaactcttct
gcaacaatgtacagtaatggagcttcccctcaattacaagctcaagctcaagctcaagct
caagcacaagctcaagcacaagcacaagctcaagcacaagcacaagcacaagcgcaagca
caagcacaagcacaggcgcaagcacaggcacaagcacaagcacaagcacatgcacaagcg
caagcacaagcacaagcacaggcacaagcacaagcacaggcgcaggcacaacaacaacaa
caacaacagcaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacagcagcagcaattacagcccctaccaagacaacagctgcagcaaaaggga
gtttctgtgcaaatgttaaatcctcaacaagggcaaccatatatcacacagccaacagtc
atacaagctcaccaactgcaaccattttctacacaagctatggaacatccgcaaagctct
caactgccacctcaacagcaacaactacaatctgttcaacatccacaacaacttcaaggc
cagcctcaagcccaagctccccaacctttaatccagcataacgtggaacagaacgtttta
cctcaaaagagatacatggaaggtgcaatccacactttagtagatgccgccgtatccagt
agcacccacacagagaataacacaaagtctcctcgtcaaccaacccatgccattccaacg
caagctcccgcaacaggaataacgaacgctgaaccacaggtaaagaagcaaaagttgaac
tctccaaattcaaacatcaacaaattagtaaatactgctacttccattgaagaaaatgca
aaatctgaggtgagcaaccaatcgccagcagtagtggagtctaataccaataatacttca
caagaagaaaaacctgtaaaagcaaactcaataccttcagtaattggcgcacaggaacct
ccacaggaagctagtcctgctgaagaagctaccaaagcagcttctgtttctccttctaca
aaaccgcttaatacggaaccagagtcatctagtgtccaaccaactgtatcatcagaaagt
tcaacaacaaaagcaaatgaccaaagcactgctgagaccatagaactttctactgctact
gttcctgcagaagcaagccctgtagaagacgaagtaagacagcattctaaagaggaaaac
ggcacaactgaagcatctgcaccttctactgaagaggcggagccagcagcttccagagat
gctgaaaaacaacaagatgaaaccgctgctacaacgataactgtaatcaaacctactttg
gaaacaatggaaacagtgaaagaggaggccaaaatgcgtgaggaagagcaaacatctcaa
gaaaaatccccacaggagaacacacttccaagagaaaatgtagtaaggcaagtggaagaa
gatgaaaactacgacgactaa

DBGET integrated database retrieval system