KEGG   Saccharomyces cerevisiae (budding yeast): YBR112CHelp
Entry
YBR112C           CDS       T00005                                 

Gene name
CYC8, CRT8, SSN6
Definition
(RefSeq) transcription regulator CYC8
  KO
K06665  
glucose repression mediator protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YBR112C (CYC8)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR112C (CYC8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(462870..465770)
Genome map
AA seq 966 aa AA seqDB search
MNPGGEQTIMEQPAQQQQQQQQQQQQQQQQAAVPQQPLDPLTQSTAETWLSIASLAETLG
DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL
GHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELD
PHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEW
QGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWY
HLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN
PYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQLENPGNINK
SNGAPTNASPAPPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQQHPAQQTPINSS
ATMYSNGASPQLQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQA
QAQAQAQAQAQAQAQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQPLPRQQLQQKG
VSVQMLNPQQGQPYITQPTVIQAHQLQPFSTQAMEHPQSSQLPPQQQQLQSVQHPQQLQG
QPQAQAPQPLIQHNVEQNVLPQKRYMEGAIHTLVDAAVSSSTHTENNTKSPRQPTHAIPT
QAPATGITNAEPQVKKQKLNSPNSNINKLVNTATSIEENAKSEVSNQSPAVVESNTNNTS
QEEKPVKANSIPSVIGAQEPPQEASPAEEATKAASVSPSTKPLNTEPESSSVQPTVSSES
STTKANDQSTAETIELSTATVPAEASPVEDEVRQHSKEENGTTEASAPSTEEAEPAASRD
AEKQQDETAATTITVIKPTLETMETVKEEAKMREEEQTSQEKSPQENTLPRENVVRQVEE
DENYDD
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgggcggtgaacaaacaataatggaacaacccgctcaacagcaacaacaacag
caacaacaacagcagcaacagcaacagcaggcagcagttcctcagcagccactcgaccca
ttaacacaatcaactgcggaaacttggctctccattgcttctttggcagaaacccttggt
gatggcgacagggccgcaatggcatatgacgccactttacagttcaatccctcatctgca
aaggctttaacatctttggctcacttgtaccgttccagagacatgttccaaagagctgca
gaattatatgaaagagcacttttggtaaatcccgaactatcagatgtgtgggctacttta
ggtcattgttatctgatgctggatgatctgcaaagagcttacaatgcctatcaacaggct
ctctaccacctcagtaatcccaacgtaccgaaattatggcatggaatcggcattctttat
gacagatatggttcgctcgactatgccgaagaagcttttgccaaagttttggaattggac
cctcattttgaaaaggcaaacgaaatttacttcagactaggtattatttataaacatcag
ggtaaatggtctcaagctttggaatgcttcagatacattctccctcaacctcctgctccc
ttgcaggagtgggacatatggtttcagttgggtagtgttttggagagtatgggagagtgg
caaggtgcgaaggaagcctacgagcatgtcttggctcaaaatcaacatcatgccaaagta
ttacaacaattaggttgtctttacggtatgagtaacgtacaattttatgaccctcaaaag
gcattggattatcttctaaagtcgttagaagcagatccctccgatgccactacatggtac
catctcggtagagtgcatatgattagaacagattatactgccgcatatgatgctttccaa
caagctgttaatagagattcaagaaaccctatcttttggtgctcaatcggtgttttatat
taccaaatttctcaatacagagacgccttagacgcgtacacaagagccataagattaaat
ccttatattagtgaagtttggtacgatctaggtactctttacgaaacttgtaacaaccaa
ttatctgacgcccttgatgcgtataagcaagctgcaagactggacgtaaataatgttcac
ataagagaaagattagaagctttaacaaagcagttagaaaacccaggcaatataaacaaa
tcgaacggtgcgccaacgaatgcctctcctgccccacctcctgtgattttacaacctacc
ttacaacctaatgatcaaggaaatcctttgaacactagaatttcagcccaatctgccaat
gctactgcttcaatggtacaacaacagcatcctgctcaacaaacgcctattaactcttct
gcaacaatgtacagtaatggagcttcccctcaattacaagctcaagctcaagctcaagct
caagcacaagctcaagcacaagcacaagctcaagcacaagcacaagcacaagcgcaagca
caagcacaagcacaggcgcaagcacaggcacaagcacaagcacaagcacatgcacaagcg
caagcacaagcacaagcacaggcacaagcacaagcacaggcgcaggcacaacaacaacaa
caacaacagcaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacagcagcagcaattacagcccctaccaagacaacagctgcagcaaaaggga
gtttctgtgcaaatgttaaatcctcaacaagggcaaccatatatcacacagccaacagtc
atacaagctcaccaactgcaaccattttctacacaagctatggaacatccgcaaagctct
caactgccacctcaacagcaacaactacaatctgttcaacatccacaacaacttcaaggc
cagcctcaagcccaagctccccaacctttaatccagcataacgtggaacagaacgtttta
cctcaaaagagatacatggaaggtgcaatccacactttagtagatgccgccgtatccagt
agcacccacacagagaataacacaaagtctcctcgtcaaccaacccatgccattccaacg
caagctcccgcaacaggaataacgaacgctgaaccacaggtaaagaagcaaaagttgaac
tctccaaattcaaacatcaacaaattagtaaatactgctacttccattgaagaaaatgca
aaatctgaggtgagcaaccaatcgccagcagtagtggagtctaataccaataatacttca
caagaagaaaaacctgtaaaagcaaactcaataccttcagtaattggcgcacaggaacct
ccacaggaagctagtcctgctgaagaagctaccaaagcagcttctgtttctccttctaca
aaaccgcttaatacggaaccagagtcatctagtgtccaaccaactgtatcatcagaaagt
tcaacaacaaaagcaaatgaccaaagcactgctgagaccatagaactttctactgctact
gttcctgcagaagcaagccctgtagaagacgaagtaagacagcattctaaagaggaaaac
ggcacaactgaagcatctgcaccttctactgaagaggcggagccagcagcttccagagat
gctgaaaaacaacaagatgaaaccgctgctacaacgataactgtaatcaaacctactttg
gaaacaatggaaacagtgaaagaggaggccaaaatgcgtgaggaagagcaaacatctcaa
gaaaaatccccacaggagaacacacttccaagagaaaatgtagtaaggcaagtggaagaa
gatgaaaactacgacgactaa

DBGET integrated database retrieval system