KEGG   Saccharomyces cerevisiae (budding yeast): YBR122CHelp
Entry
YBR122C           CDS       T00005                                 

Gene name
MRPL36
Definition
mitochondrial 54S ribosomal protein YmL36
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(483970..484503)
Genome map
AA seq 177 aa AA seqDB search
MLKSIFAKRFASTGSYPGSTRITLPRRPAKKIQLGKSRPAIYHQFNVKMELSDGSVVIRR
SQYPKGEIRLIQDQRNNPLWNPSRDDLVVVDANSGGSLDRFNKRYSSLFSVDSTTPNSSS
ETVELSEENKKKTQIKKEEKEDVSEKAFGMDDYLSLLDDSEQQIKSGKLASKKRDKK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagtctatatttgcgaagcgatttgcttccacagggtcatatcctggttctaca
agaattactttgccaagaaggcctgcaaaaaaaattcaactggggaagtcacgaccggct
atttatcaccaattcaatgtcaaaatggagttgagtgatggaagtgtagttatccggaga
tcccaatatccaaagggtgaaattagattaattcaagaccagagaaataatccgctgtgg
aatcctagcagggatgacctagtcgttgtggatgctaattctggtggtagcttggacaga
tttaacaagaggtatagctctttgttttctgtcgattcaacgaccccaaattcaagctct
gaaacagttgaactatctgaagaaaataaaaagaaaacacagattaaaaaggaggagaag
gaagacgtttctgaaaaagcgttcggtatggatgactatctatctctgttagacgatagt
gaacaacagatcaaatcaggtaagttggccagtaagaagagagacaagaagtga

DBGET integrated database retrieval system