KEGG   Saccharomyces cerevisiae (budding yeast): YBR122CHelp
Entry
YBR122C           CDS       T00005                                 

Gene name
MRPL36
Definition
mitochondrial 54S ribosomal protein YmL36
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(483970..484503)
Genome map
AA seq 177 aa AA seqDB search
MLKSIFAKRFASTGSYPGSTRITLPRRPAKKIQLGKSRPAIYHQFNVKMELSDGSVVIRR
SQYPKGEIRLIQDQRNNPLWNPSRDDLVVVDANSGGSLDRFNKRYSSLFSVDSTTPNSSS
ETVELSEENKKKTQIKKEEKEDVSEKAFGMDDYLSLLDDSEQQIKSGKLASKKRDKK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagtctatatttgcgaagcgatttgcttccacagggtcatatcctggttctaca
agaattactttgccaagaaggcctgcaaaaaaaattcaactggggaagtcacgaccggct
atttatcaccaattcaatgtcaaaatggagttgagtgatggaagtgtagttatccggaga
tcccaatatccaaagggtgaaattagattaattcaagaccagagaaataatccgctgtgg
aatcctagcagggatgacctagtcgttgtggatgctaattctggtggtagcttggacaga
tttaacaagaggtatagctctttgttttctgtcgattcaacgaccccaaattcaagctct
gaaacagttgaactatctgaagaaaataaaaagaaaacacagattaaaaaggaggagaag
gaagacgtttctgaaaaagcgttcggtatggatgactatctatctctgttagacgatagt
gaacaacagatcaaatcaggtaagttggccagtaagaagagagacaagaagtga

DBGET integrated database retrieval system