KEGG   Saccharomyces cerevisiae (budding yeast): YBR133CHelp
Entry
YBR133C           CDS       T00005                                 

Gene name
HSL7
Definition
Hsl7p (EC:2.1.1.125)
Orthology
K02516  
protein arginine N-methyltransferase 5 [EC:2.1.1.125]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YBR133C (HSL7)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR133C (HSL7)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.125  histone-arginine N-methyltransferase
     YBR133C (HSL7)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YBR133C (HSL7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:complement(501804..504287)
Genome map
AA seq 827 aa AA seqDB search
MHSNVFVGVKPGFNHKQHSKKSRFLENVSSHSPELPSNYDYVLLPITTPRYKEIVGQVFK
DFQRQSIQNWKPLQIPEPQLQDICIPPFNVKKLDNDDTPSYIGLLSSWLELESRDPNVRD
LGLKVLLNECKYARFVGINKLILAPPRDLSNLQLYGQMIYRLLQNRIVFAAPALTISISL
PLYEDSDPLATWELWNTVRKQCEYHPSLTISLALPRTRTPSYVLNRWLAEPVSCLLVSSS
IFASNQYDYPVLHKFNQNLILKFQKVNGDSQILGNELCVILHGMEKYANNVKGGESAYLE
YINYLLKKGDKVLNSNSNHQFLLQEDSRIMPPLKPHSDNLLNSTYLTFEKDLVKYDLYES
AILEALQDLAPRASAKRPLVILVAGAGRGPLVDRTFKIISMLFMDSKVSIIAIEKNPQAY
LYLQKRNFDCWDNRVKLIKEDMTKWQINEPSEKRIQIDLCISELLGSFGCNELSPECLWS
IEKYHSHNDTIFIPRSYSSYIAPISSPLFYQKLSQTNRSLEAPWIVHRVPYCILSSRVNE
VWRFEHPMAQKDTVQDEDDFTVEFSQSSLNEFKIKHRGEIHGFIGFFSANLYNNIFLSTL
PNDSTVRLKFSEETLMNTRREENLIKKCDHTPNMTSWSPIIFPLKQPISFIDDSELSVLM
SRIHSDTEQKVWYEWSLESFIYLMLSNYTSAVTAASMTIPRSIVTDDTKTLAHNRHYSAT
TNQKLDNQIDLDQDIENEEEQGFLSNLETGWQSVQDIHGLSETAKPDHLDSINKPMFDLK
STKALEPSNELPRHEDLEEDVPEVHVRVKTSVSTLHNVCGRAFSLPL
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgcatagcaacgtatttgttggtgtcaaaccaggctttaatcataaacagcacagcaaa
aagtcacgtttcctagaaaatgtctctagtcattcaccagaactgcctagtaactatgat
tacgttttgcttcctataacaacgccaagatataaggaaatagttgggcaagttttcaaa
gatttccaaagacaatccatacagaactggaaaccgcttcaaattcctgaaccgcagttg
caggatatctgtatacccccgttcaacgtcaagaagctagacaatgacgatacgccgtct
tacatagggctgttatcctcttggctggagctggagagtcgcgatccaaatgtaagagat
cttggcttaaaggtccttctaaacgaatgtaagtacgcgaggtttgttggaatcaataag
ctaatattggcgcctccacgggacctgtccaacctgcaattgtatggacagatgatttac
aggctcctgcaaaatcgcatcgtctttgctgcgcctgcgttaaccatatccatttctctg
ccactttacgaagacagcgatccattggccacttgggaactgtggaataccgtgcggaaa
caatgcgaatatcatccctctttgactatctctttggctttgccaagaaccaggactcct
tcgtatgtgctgaatagatggttagccgaacccgtctcgtgtcttttggtatcttcatcc
atctttgccagtaatcagtacgattatcccgttttacacaagtttaaccagaatttgatt
ttaaagttccaaaaggttaatggagattcacaaattttgggtaatgaattatgcgtgata
ttgcatgggatggagaaatatgccaataatgttaagggcggagaatctgcctatttggaa
tatataaactacttattgaaaaagggcgacaaagtattaaattccaatagtaatcaccaa
tttttgctccaagaggactctcggataatgccgcctctgaaacctcattcagataattta
ttaaattccacatatttgacttttgaaaaagatttggtgaagtacgatctttacgaatct
gccatattagaggcgcttcaagatcttgctcctcgagcgagtgccaagagaccgttggtg
atcctagtagccggtgcgggaagaggacctttagtggatcgaacttttaagataatatca
atgttgtttatggatagtaaggtttctataattgccattgaaaaaaatccacaggcatat
ctgtacttgcaaaaaagaaatttcgactgttgggataatagagtgaaattaatcaaggag
gatatgaccaaatggcaaatcaacgagccgtcggaaaagcgtattcagatagatctgtgc
ataagtgaactgctgggttcgttcggttgcaatgaattatcaccagaatgtctctggtct
attgaaaaatatcattcccacaatgacacaattttcataccgaggtcatactcttcatac
atagcacccatttcgtcaccattattctaccaaaaactctcacaaacaaatcgctctttg
gaggcgccctggatagtccatagagtgccatactgtatattatcctcaagggtaaatgaa
gtgtggcggttcgagcatcccatggcccaaaaagatactgtccaagacgaagatgatttt
acagttgaattttctcaaagttcattaaatgagttcaagataaagcaccgcggcgaaatc
catggctttatcggattcttctcggcaaacttatataacaatatattcttgtcaactttg
cccaatgacagcacagtccgtttaaaatttagcgaagaaacgttgatgaataccagacga
gaagaaaatctaatcaagaaatgtgaccatacaccaaatatgacctcgtggtctccaatt
atctttcctttgaagcaaccaatatcctttatagatgactccgaactttctgtgctgatg
tctcggatacactccgatacagaacaaaaagtttggtatgaatggtctttggagagtttc
atataccttatgttgtcaaattacacttcggcggtaactgctgcaagcatgactattccg
aggtctatagttacagatgacactaaaactttagcccataatcgacattattcagcgact
accaatcaaaagctagataatcaaattgatcttgaccaagacattgaaaacgaagaagaa
cagggattcctatccaatctagaaactggttggcaaagcgtacaagatattcacggactc
agcgaaaccgccaaaccggaccatttagattctatcaataagcctatgtttgatctcaaa
tctactaaagcgcttgaaccctctaacgaattgccaaggcacgaagacctcgaggaagat
gttccagaagttcatgtcagagtcaagactagtgtttccacgctacataatgtctgtggc
agagccttttccctgcctctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system