KEGG   Saccharomyces cerevisiae (budding yeast): YBR135WHelp
Entry
YBR135W           CDS       T00005                                 

Gene name
CKS1
Definition
Cks1p
Orthology
K02219  
cyclin-dependent kinase regulatory subunit CKS1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:504854..505306
Genome map
AA seq 150 aa AA seqDB search
MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFN
SEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQ
QQQQQQQQQQQQQHQTQSISNDMQVPPQIS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatcactatcacgccttccaaggcagaaagcttactgaccaagaaagagcacgc
gtgttggagtttcaagattccattcactattctccgcggtactcagacgataactatgag
tacaggcatgtgatgttacctaaggccatgctaaaagttatcccatctgattacttcaat
tcggaagtggggaccctgcgtatattaacagaagacgaatggagaggcctcggcatcaca
cagtctttggggtgggaacattatgaatgccatgcgccagaaccacacattttgctattc
aaaaggccgctgaactacgaggccgagctgagggcagcgaccgctgctgctcaacagcaa
cagcaacagcagcaacagcagcaacaacaacaacagcaacatcaaacacaatcgatttcg
aacgatatgcaagttccaccccaaatctcctag

DBGET integrated database retrieval system