KEGG   Saccharomyces cerevisiae (budding yeast): YBR135WHelp
Entry
YBR135W           CDS       T00005                                 

Gene name
CKS1
Definition
(RefSeq) cyclin-dependent protein kinase regulatory subunit CKS1
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR135W (CKS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CKS SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 852432
NCBI-ProteinID: NP_009693
SGD: S000000339
UniProt: P20486
Structure
PDB: 

Jmol
Position
II:504854..505306
Genome map
AA seq 150 aa AA seqDB search
MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFN
SEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQ
QQQQQQQQQQQQQHQTQSISNDMQVPPQIS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatcactatcacgccttccaaggcagaaagcttactgaccaagaaagagcacgc
gtgttggagtttcaagattccattcactattctccgcggtactcagacgataactatgag
tacaggcatgtgatgttacctaaggccatgctaaaagttatcccatctgattacttcaat
tcggaagtggggaccctgcgtatattaacagaagacgaatggagaggcctcggcatcaca
cagtctttggggtgggaacattatgaatgccatgcgccagaaccacacattttgctattc
aaaaggccgctgaactacgaggccgagctgagggcagcgaccgctgctgctcaacagcaa
cagcaacagcagcaacagcagcaacaacaacaacagcaacatcaaacacaatcgatttcg
aacgatatgcaagttccaccccaaatctcctag

DBGET integrated database retrieval system