KEGG   Saccharomyces cerevisiae (budding yeast): YBR136WHelp
Entry
YBR136W           CDS       T00005                                 

Gene name
MEC1, ESR1, RAD31, SAD3
Definition
(RefSeq) protein kinase MEC1
  KO
K02543  
cell cycle checkpoint protein MEC1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR136W (MEC1)
   04113 Meiosis - yeast
    YBR136W (MEC1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    YBR136W (MEC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:505668..512774
Genome map
AA seq 2368 aa AA seqDB search
MESHVKYLDELILAIKDLNSGVDSKVQIKKVPTDPSSSQEYAKSLKILNTLIRNLKDQRR
NNIMKNDTIFSKTVSALALLLEYNPFLLVMKDSNGNFEIQRLIDDFLNISVLNYDNYHRI
WFMRRKLGSWCKACVEFYGKPAKFQLTAHFENTMNLYEQALTEVLLGKTELLKFYDTLKG
LYILLYWFTSEYSTFGNSIAFLDSSLGFTKFDFNFQRLIRIVLYVFDSCELAALEYAEIQ
LKYISLVVDYVCNRTISTALDAPALVCCEQLKFVLTTMHHFLDNKYGLLDNDPTMAKGIL
RLYSLCISNDFSKCFVDHFPIDQWADFSQSEHFPFTQLTNKALSIVYFDLKRRSLPVEAL
KYDNKFNIWVYQSEPDSSLKNVTSPFDDRYKQLEKLRLLVLKKFNKTERGTLLKYRVNQL
SPGFFQRAGNDFKLILNEASVSIQTCFKTNNITRLTSWTVILGRLACLESEKFSGTLPNS
TKDMDNWYVCHLCDIEKTGNPFVRINPNRPEAAGKSEIFRILHSNFLSHPNIDEFSESLL
SGILFSLHRIFSHFQPPKLTDGNGQINKSFKLVQKCFMNSNRYLRLLSTRIIPLFNISDS
HNSEDEHTATLIKFLQSQKLPVVKENLVIAWTQLTLTTSNDVFDTLLLKLIDIFNSDDYS
LRIMMTLQIKNMAKILKKTPYQLLSPILPVLLRQLGKNLVERKVGFQNLIELLGYSSKTI
LDIFQRYIIPYAIIQYKSDVLSEIAKIMCDGDTSLINQMKVNLLKKNSRQIFAVALVKHG
LFSLDILETLFLNRAPTFDKGYITAYLPDYKTLAEITKLYKNSVTKDASDSENANMILCS
LRFLITNFEKDKRHGSKYKNINNWTDDQEQAFQKKLQDNILGIFQVFSSDIHDVEGRTTY
YEKLRVINGISFLIIYAPKKSIISALAQISICLQTGLGLKEVRYEAFRCWHLLVRHLNDE
ELSTVIDSLIAFILQKWSEFNGKLRNIVYSILDTLIKEKSDLILKLKPYTTLALVGKPEL
GILARDGQFARMVNKIRSTTDLIPIFANNLKSSNKYVINQNLDDIEVYLRRKQTERSIDF
TPKKVGQTSDITLVLGALLDTSHKFRNLDKDLCEKCAKCISMIGVLDVTKHEFKRTTYSE
NEVYDLNDSVQTIKFLIWVINDILVPAFWQSENPSKQLFVALVIQESLKYCGLSSESWDM
NHKELYPNEAKLWEKFNSVSKTTIYPLLSSLYLAQSWKEYVPLKYPSNNFKEGYKIWVKR
FTLDLLKTGTTENHPLHVFSSLIREDDGSLSNFLLPYISLDIIIKAEKGTPYADILNGII
IEFDSIFTCNLEGMNNLQVDSLRMCYESIFRVFEYCKKWATEFKQNYSKLHGTFIIKDTK
TTNMLLRIDEFLRTTPSDLLAQRSLETDSFERSALYLEQCYRQNPHDKNQNGQLLKNLQI
TYEEIGDIDSLDGVLRTFATGNLVSKIEELQYSENWKLAQDCFNVLGKFSDDPKTTTRML
KSMYDHQLYSQIISNSSFHSSDGKISLSPDVKEWYSIGLEAANLEGNVQTLKNWVEQIES
LRNIDDREVLLQYNIAKALIAISNEDPLRTQKYIHNSFRLIGTNFITSSKETTLLKKQNL
LMKLHSLYDLSFLSSAKDKFEYKSNTTILDYRMERIGADFVPNHYILSMRKSFDQLKMNE
QADADLGKTFFTLAQLARNNARLDIASESLMHCLERRLPQAELEFAEILWKQGENDRALK
IVQEIHEKYQENSSVNARDRAAVLLKFTEWLDLSNNSASEQIIKQYQDIFQIDSKWDKPY
YSIGLYYSRLLERKKAEGYITNGRFEYRAISYFLLAFEKNTAKVRENLPKVITFWLDIAA
ASISEAPGNRKEMLSKATEDICSHVEEALQHCPTYIWYFVLTQLLSRLLHSHQSSAQIIM
HILLSLAVEYPSHILWYITALVNSNSSKRVLRGKHILEKYRQHSQNPHDLVSSALDLTKA
LTRVCLQDVKSITSRSGKSLEKDFKFDMNVAPSAMVVPVRKNLDIISPLESNSMRGYQPF
RPVVSIIRFGSSYKVFSSLKKPKQLNIIGSDGNIYGIMCKKEDVRQDNQYMQFATTMDFL
LSKDIASRKRSLGINIYSVLSLREDCGILEMVPNVVTLRSILSTKYESLKIKYSLKSLHD
RWQHTAVDGKLEFYMEQVDKFPPILYQWFLENFPDPINWFNARNTYARSYAVMAMVGHIL
GLGDRHCENILLDIQTGKVLHVDFDCLFEKGKRLPVPEIVPFRLTPNLLDALGIIGTEGT
FKKSSEVTLALMRKNEVALMNVIETIMYDRNMDHSIQKALKVLRNKIRGIDPQDGLVLSV
AGQTETLIQEATSEDNLSKMYIGWLPFW
NT seq 7107 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacacgtcaaatatcttgacgaattgatattggcaataaaagacctgaactcg
ggggtggattcaaaggtgcagattaaaaaagtgcccacggatccatcttcttctcaggag
tacgccaagagtttaaagatcctgaacaccctcataagaaacctaaaagatcaaagaagg
aacaatatcatgaaaaatgatactatattttcgaaaacagtttccgcccttgccttattg
ttggagtacaaccccttcttgcttgttatgaaggattccaacgggaactttgagatacaa
aggctgatagatgatttcctcaacatatccgttctgaactatgataattaccacagaata
tggtttatgaggcgaaaattaggcagctggtgcaaagcatgtgtcgaattttacggaaaa
cctgctaagtttcagcttactgcacattttgagaacaccatgaatctttacgaacaggcc
ttgactgaagtcttgttgggcaagactgagcttctcaaattttatgacaccttgaagggt
ctatacattcttttatactggttcacttcggagtatagtacttttgggaactctatagca
ttcttagattcttctttggggttcacgaaatttgactttaacttccaacgattaatcagg
attgttctttacgtctttgattcctgcgaactagcagcactagaatatgccgaaatccaa
ctcaaatatatttctctagttgtggactatgtttgcaatagaacaatttccacagccctg
gatgccccagcgttagtttgttgtgaacaattaaagtttgtattgactactatgcatcat
tttttggataacaagtatgggctcttggataatgaccccactatggccaaaggaattctt
cgactatattctctttgcatttctaacgatttctcaaaatgctttgtagaccacttccca
attgaccagtgggcagatttttcacaaagtgaacattttccgttcacgcagttgactaat
aaagctctctcgattgtatattttgatttgaaaagaaggtccctacctgttgaagcttta
aagtacgataataagttcaacatctgggtataccaatcggagccggactcgagcttgaaa
aatgtcacttctccctttgatgatcgatataagcagctggaaaagctaaggttgctagta
ctaaagaagtttaacaagacagaaagaggaactttgctcaaataccgcgtgaaccagcta
agtcctggattttttcaaagagctggaaacgatttcaagctaattttaaatgaagcatct
gtatccattcaaacttgtttcaagacaaacaatataacaaggctaacatcatggactgta
attctcggacgtctagcctgtctagaatcagagaagttttccggcactctgccaaattcc
acaaaggatatggataattggtatgtttgtcatttatgcgatattgagaaaactggcaac
cctttcgtgcgaataaatccaaatagaccagaggctgcgggtaaatcagaaatcttcagg
atacttcattcaaactttctatctcacccaaatatagatgaatttagcgaatctttgtta
agtggcatcttattttctctacataggatattttcacactttcaacctccaaaacttaca
gatggaaacggtcaaatcaataagagctttaaactggtacaaaagtgctttatgaattct
aacagatacctacgtttattaagtactagaattatacctttattcaatatatcagactct
cataattccgaagatgaacacactgccacgctgataaagtttctacaatctcaaaaattg
ccagtggtgaaagaaaatttagtcattgcttggacacaattaacattgacgacttctaat
gatgtatttgatacactacttttgaaactgattgatattttcaattctgatgattatagt
ttacgaataatgatgactttgcaaattaaaaatatggccaaaattttaaagaaaacacca
tatcaattactatcgcctattttacctgtattactaagacagttgggaaaaaacctcgtg
gaaagaaaagttggctttcaaaatttaatagaattattgggatattcttcaaaaacaatt
ctcgatattttccagagatatatcatcccttatgcaattattcaatataagagcgatgtg
ctaagtgaaattgctaagattatgtgtgatggcgatacaagtttaattaaccaaatgaag
gttaatttactgaaaaaaaacagtaggcaaatatttgccgtagctttggtaaaacacgga
ttattttctttggatatcttggaaaccctttttttaaatagggctccaacttttgacaaa
ggatatataactgcataccttcccgattataaaactttagctgaaataacgaagctctac
aaaaacagcgttactaaagatgcaagtgacagcgagaatgctaatatgattttatgctct
ttgcgatttttaatcaccaattttgaaaaagacaaaaggcatggttcgaagtacaaaaat
atcaataactggacggatgatcaggaacaagcgttccaaaagaaactacaggataatatc
ttaggtattttccaagttttttcgagtgacatacatgatgttgaaggccgcaccacttac
tacgaaaagttaagggttatcaatggcatttcttttcttatcatatatgcccccaaaaaa
tcaataatttccgcattagcccagattagtatttgtttgcaaacaggacttgggcttaag
gaagttcgatacgaggcctttagatgttggcatctgttagttcgccatctaaatgatgaa
gaactctctactgttatagatagcttaattgcattcatacttcaaaagtggtctgagttc
aacggaaaacttcgaaatatagtgtacagtatactggataccttaatcaaagagaaatcg
gacctgattttgaaattaaaaccttacactactttggctttagtaggcaagcctgaatta
ggtattttagctcgtgatggccaatttgcaagaatggtgaataaaataagaagtaccacg
gaccttatacccatatttgctaataacttgaaaagtagtaacaagtatgtcataaaccaa
aatttagacgatatagaggtatatcttcggagaaagcagacagaaagatcgattgatttt
acaccaaagaaggttgggcaaacttctgatataacattagttttgggtgctttattagac
acttctcataagtttagaaatttagacaaggacctatgcgagaagtgcgccaaatgtatc
agtatgattggtgttttagacgttacaaagcatgagtttaaaagaacaacatattcagaa
aacgaagtttatgatttgaatgatagtgttcaaactattaagttcttgatatgggtcata
aatgatatcctcgttcctgcgttttggcaaagtgagaatcccagcaagcaattgtttgtt
gcccttgtcatacaggaatcattaaaatattgcgggctaagttcagagtcatgggatatg
aaccataaagaattatatccaaatgaagccaaactatgggaaaagtttaactctgtctcc
aagacaaccatctatccgcttttatcttccttgtatcttgcgcaatcatggaaagaatat
gtcccgctaaaatatccttctaataacttcaaggaaggatacaaaatttgggtgaaaagg
tttacattggatttattgaaaacaggtacaacagaaaatcatccattacacgtgttttcc
tctttgattagggaagatgatggctcactatcaaattttttgctaccttatatttctctg
gacattattatcaaggcagaaaaaggaactccatacgctgatattttaaacgggattatt
attgaatttgacagcattttcacgtgcaatctggaaggaatgaataacttgcaagtggat
tcgttaagaatgtgctatgaatccatcttcagagttttcgaatattgcaaaaaatgggca
actgagtttaaacaaaattacagtaaactacacggcacttttatcattaaagatacgaaa
acaactaacatgcttttgagaatagatgagtttttgcgaacaaccccttcagatttgcta
gctcaacgctccttagagacggattcttttgaaaggtctgctctataccttgaacagtgc
tatcgacagaatcctcacgataagaaccaaaatggacaactactgaaaaatttacaaatc
acatacgaagaaataggagacattgactcactcgatggtgtactgagaacctttgctaca
ggaaacttggtttctaaaattgaagaattgcaatattctgaaaactggaaactcgcacaa
gactgctttaatgtcctcggcaaattttcagatgaccccaaaactacaaccaggatgcta
aagtctatgtatgaccaccaattgtattctcaaataatatcgaactcttcgttccattct
tcagacggaaaaatttctttgtctccagatgtgaaggaatggtacagcataggtcttgaa
gctgcaaatctagaaggcaatgttcaaactttgaaaaattgggtagaacaaatagagagt
ttaagaaatattgacgatagagaagtacttttgcagtacaatattgcgaaagctttaatt
gccatctcaaacgaggatccattaaggactcaaaaatacatccacaattcctttaggctt
atcggaacaaattttataacgtcatctaaagagacgacgctgctaaagaaacagaattta
ttgatgaaattacacagtttatatgacctcagttttttatcttctgcgaaagataagttt
gaatacaaaagtaacactaccatactcgattatcgaatggaacgtattggggctgacttc
gtgccaaatcattacatattgtcaatgagaaagtcatttgaccaattgaaaatgaatgaa
caagcagacgctgacttaggaaaaacattcttcactttagcccaattggcgagaaacaac
gctaggctagatatagcctccgaatcattaatgcattgtttggaaaggcggttgcctcag
gcagagttggagtttgctgaaatactatggaagcaaggtgagaatgatagagccttaaag
atagtgcaagaaatacatgaaaagtatcaagaaaattcctcggttaatgctcgcgatcgt
gccgccgtgctattaaagtttactgaatggttagacctttcgaacaattcagcgtccgaa
caaattattaaacaatatcaggatatttttcagattgattctaaatgggataaaccatat
tactctattggcttatactatagtagactacttgagcgcaaaaaagcagagggttatatt
actaatggtcgttttgagtacagggcaatatcttactttttattggcatttgaaaagaac
actgctaaagtaagagaaaatttgcccaaagttatcacgttttggctagatattgcggcc
gcatcaatttctgaagctcctggaaacagaaaggaaatgctgagtaaggctacggaagat
atatgtagtcatgttgaagaagcgctgcagcattgtcccacttatatttggtactttgtt
ttgactcagttgttatctaggttattacattctcatcaatcatcggcccagataataatg
cacatactgctaagtttggctgttgaatacccctctcatattttatggtatatcacagcc
cttgtaaattccaattcttcaaaaagagttcttcgtggtaagcatattttagaaaagtat
agacaacattcgcaaaatcctcatgatctagtttctagtgcattggatttaacgaaagca
ttaactcgtgtctgtttgcaagatgtcaaaagcattacaagtagatcaggcaaatcttta
gaaaaagacttcaaatttgacatgaacgtggccccatctgcaatggttgttccagtaaga
aaaaatttagacatcatttcaccactagagtctaactcaatgaggggctatcaaccattt
aggccggttgtttctataattagattcggatcatcttataaagtgttttcttcattaaag
aagccaaaacaattgaacataataggttcagatggcaacatttatgggatcatgtgtaag
aaggaagatgtccgacaagataaccaatatatgcagttcgccacaacaatggattttctt
ctgagtaaggacatagcttcaagaaaaagaagcctgggcataaatatttactccgtacta
tctcttcgagaagactgtgggatattggaaatggtaccgaatgttgtaactttaagatct
attctttctacaaagtacgaaagtctgaaaattaagtatagcctgaaaagtctacatgat
aggtggcagcacaccgcagtagatggaaaactcgagttttacatggaacaggtagataaa
tttcctccaatcttgtaccaatggtttttagaaaactttcctgatccaatcaattggttc
aacgccaggaatacgtatgccagatcttacgccgtcatggcaatggttggccatatatta
ggtctaggtgataggcactgtgaaaacatattactagatatacagacgggtaaagttctt
catgtagacttcgactgtttatttgagaaaggcaaaaggttacctgtcccagaaattgtt
cccttcagactaacaccaaatttattggatgcgttgggcataattgggacagaaggaaca
tttaagaagtctagtgaagtcacgttggctttaatgagaaaaaatgaagtagcgttgatg
aatgtgatcgaaacaattatgtacgatagaaacatggaccactcaattcaaaaagcgcta
aaggtcttaagaaacaaaatccgcggtatagatccgcaggatggcctggtattgagtgtt
gctggccaaacagaaacattgatccaagaagcaacatcagaagacaatctaagcaagatg
tatattggttggcttccattttggtaa

DBGET integrated database retrieval system