KEGG   Saccharomyces cerevisiae (budding yeast): YBR136WHelp
Entry
YBR136W           CDS       T00005                                 

Gene name
MEC1, ESR1, RAD31, SAD3
Definition
Mec1p (EC:2.7.11.1)
Orthology
K02543  
cell cycle checkpoint protein MEC1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR136W (MEC1)
   04113 Meiosis - yeast
    YBR136W (MEC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:505668..512774
Genome map
AA seq 2368 aa AA seqDB search
MESHVKYLDELILAIKDLNSGVDSKVQIKKVPTDPSSSQEYAKSLKILNTLIRNLKDQRR
NNIMKNDTIFSKTVSALALLLEYNPFLLVMKDSNGNFEIQRLIDDFLNISVLNYDNYHRI
WFMRRKLGSWCKACVEFYGKPAKFQLTAHFENTMNLYEQALTEVLLGKTELLKFYDTLKG
LYILLYWFTSEYSTFGNSIAFLDSSLGFTKFDFNFQRLIRIVLYVFDSCELAALEYAEIQ
LKYISLVVDYVCNRTISTALDAPALVCCEQLKFVLTTMHHFLDNKYGLLDNDPTMAKGIL
RLYSLCISNDFSKCFVDHFPIDQWADFSQSEHFPFTQLTNKALSIVYFDLKRRSLPVEAL
KYDNKFNIWVYQSEPDSSLKNVTSPFDDRYKQLEKLRLLVLKKFNKTERGTLLKYRVNQL
SPGFFQRAGNDFKLILNEASVSIQTCFKTNNITRLTSWTVILGRLACLESEKFSGTLPNS
TKDMDNWYVCHLCDIEKTGNPFVRINPNRPEAAGKSEIFRILHSNFLSHPNIDEFSESLL
SGILFSLHRIFSHFQPPKLTDGNGQINKSFKLVQKCFMNSNRYLRLLSTRIIPLFNISDS
HNSEDEHTATLIKFLQSQKLPVVKENLVIAWTQLTLTTSNDVFDTLLLKLIDIFNSDDYS
LRIMMTLQIKNMAKILKKTPYQLLSPILPVLLRQLGKNLVERKVGFQNLIELLGYSSKTI
LDIFQRYIIPYAIIQYKSDVLSEIAKIMCDGDTSLINQMKVNLLKKNSRQIFAVALVKHG
LFSLDILETLFLNRAPTFDKGYITAYLPDYKTLAEITKLYKNSVTKDASDSENANMILCS
LRFLITNFEKDKRHGSKYKNINNWTDDQEQAFQKKLQDNILGIFQVFSSDIHDVEGRTTY
YEKLRVINGISFLIIYAPKKSIISALAQISICLQTGLGLKEVRYEAFRCWHLLVRHLNDE
ELSTVIDSLIAFILQKWSEFNGKLRNIVYSILDTLIKEKSDLILKLKPYTTLALVGKPEL
GILARDGQFARMVNKIRSTTDLIPIFANNLKSSNKYVINQNLDDIEVYLRRKQTERSIDF
TPKKVGQTSDITLVLGALLDTSHKFRNLDKDLCEKCAKCISMIGVLDVTKHEFKRTTYSE
NEVYDLNDSVQTIKFLIWVINDILVPAFWQSENPSKQLFVALVIQESLKYCGLSSESWDM
NHKELYPNEAKLWEKFNSVSKTTIYPLLSSLYLAQSWKEYVPLKYPSNNFKEGYKIWVKR
FTLDLLKTGTTENHPLHVFSSLIREDDGSLSNFLLPYISLDIIIKAEKGTPYADILNGII
IEFDSIFTCNLEGMNNLQVDSLRMCYESIFRVFEYCKKWATEFKQNYSKLHGTFIIKDTK
TTNMLLRIDEFLRTTPSDLLAQRSLETDSFERSALYLEQCYRQNPHDKNQNGQLLKNLQI
TYEEIGDIDSLDGVLRTFATGNLVSKIEELQYSENWKLAQDCFNVLGKFSDDPKTTTRML
KSMYDHQLYSQIISNSSFHSSDGKISLSPDVKEWYSIGLEAANLEGNVQTLKNWVEQIES
LRNIDDREVLLQYNIAKALIAISNEDPLRTQKYIHNSFRLIGTNFITSSKETTLLKKQNL
LMKLHSLYDLSFLSSAKDKFEYKSNTTILDYRMERIGADFVPNHYILSMRKSFDQLKMNE
QADADLGKTFFTLAQLARNNARLDIASESLMHCLERRLPQAELEFAEILWKQGENDRALK
IVQEIHEKYQENSSVNARDRAAVLLKFTEWLDLSNNSASEQIIKQYQDIFQIDSKWDKPY
YSIGLYYSRLLERKKAEGYITNGRFEYRAISYFLLAFEKNTAKVRENLPKVITFWLDIAA
ASISEAPGNRKEMLSKATEDICSHVEEALQHCPTYIWYFVLTQLLSRLLHSHQSSAQIIM
HILLSLAVEYPSHILWYITALVNSNSSKRVLRGKHILEKYRQHSQNPHDLVSSALDLTKA
LTRVCLQDVKSITSRSGKSLEKDFKFDMNVAPSAMVVPVRKNLDIISPLESNSMRGYQPF
RPVVSIIRFGSSYKVFSSLKKPKQLNIIGSDGNIYGIMCKKEDVRQDNQYMQFATTMDFL
LSKDIASRKRSLGINIYSVLSLREDCGILEMVPNVVTLRSILSTKYESLKIKYSLKSLHD
RWQHTAVDGKLEFYMEQVDKFPPILYQWFLENFPDPINWFNARNTYARSYAVMAMVGHIL
GLGDRHCENILLDIQTGKVLHVDFDCLFEKGKRLPVPEIVPFRLTPNLLDALGIIGTEGT
FKKSSEVTLALMRKNEVALMNVIETIMYDRNMDHSIQKALKVLRNKIRGIDPQDGLVLSV
AGQTETLIQEATSEDNLSKMYIGWLPFW
NT seq 7107 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacacgtcaaatatcttgacgaattgatattggcaataaaagacctgaactcg
ggggtggattcaaaggtgcagattaaaaaagtgcccacggatccatcttcttctcaggag
tacgccaagagtttaaagatcctgaacaccctcataagaaacctaaaagatcaaagaagg
aacaatatcatgaaaaatgatactatattttcgaaaacagtttccgcccttgccttattg
ttggagtacaaccccttcttgcttgttatgaaggattccaacgggaactttgagatacaa
aggctgatagatgatttcctcaacatatccgttctgaactatgataattaccacagaata
tggtttatgaggcgaaaattaggcagctggtgcaaagcatgtgtcgaattttacggaaaa
cctgctaagtttcagcttactgcacattttgagaacaccatgaatctttacgaacaggcc
ttgactgaagtcttgttgggcaagactgagcttctcaaattttatgacaccttgaagggt
ctatacattcttttatactggttcacttcggagtatagtacttttgggaactctatagca
ttcttagattcttctttggggttcacgaaatttgactttaacttccaacgattaatcagg
attgttctttacgtctttgattcctgcgaactagcagcactagaatatgccgaaatccaa
ctcaaatatatttctctagttgtggactatgtttgcaatagaacaatttccacagccctg
gatgccccagcgttagtttgttgtgaacaattaaagtttgtattgactactatgcatcat
tttttggataacaagtatgggctcttggataatgaccccactatggccaaaggaattctt
cgactatattctctttgcatttctaacgatttctcaaaatgctttgtagaccacttccca
attgaccagtgggcagatttttcacaaagtgaacattttccgttcacgcagttgactaat
aaagctctctcgattgtatattttgatttgaaaagaaggtccctacctgttgaagcttta
aagtacgataataagttcaacatctgggtataccaatcggagccggactcgagcttgaaa
aatgtcacttctccctttgatgatcgatataagcagctggaaaagctaaggttgctagta
ctaaagaagtttaacaagacagaaagaggaactttgctcaaataccgcgtgaaccagcta
agtcctggattttttcaaagagctggaaacgatttcaagctaattttaaatgaagcatct
gtatccattcaaacttgtttcaagacaaacaatataacaaggctaacatcatggactgta
attctcggacgtctagcctgtctagaatcagagaagttttccggcactctgccaaattcc
acaaaggatatggataattggtatgtttgtcatttatgcgatattgagaaaactggcaac
cctttcgtgcgaataaatccaaatagaccagaggctgcgggtaaatcagaaatcttcagg
atacttcattcaaactttctatctcacccaaatatagatgaatttagcgaatctttgtta
agtggcatcttattttctctacataggatattttcacactttcaacctccaaaacttaca
gatggaaacggtcaaatcaataagagctttaaactggtacaaaagtgctttatgaattct
aacagatacctacgtttattaagtactagaattatacctttattcaatatatcagactct
cataattccgaagatgaacacactgccacgctgataaagtttctacaatctcaaaaattg
ccagtggtgaaagaaaatttagtcattgcttggacacaattaacattgacgacttctaat
gatgtatttgatacactacttttgaaactgattgatattttcaattctgatgattatagt
ttacgaataatgatgactttgcaaattaaaaatatggccaaaattttaaagaaaacacca
tatcaattactatcgcctattttacctgtattactaagacagttgggaaaaaacctcgtg
gaaagaaaagttggctttcaaaatttaatagaattattgggatattcttcaaaaacaatt
ctcgatattttccagagatatatcatcccttatgcaattattcaatataagagcgatgtg
ctaagtgaaattgctaagattatgtgtgatggcgatacaagtttaattaaccaaatgaag
gttaatttactgaaaaaaaacagtaggcaaatatttgccgtagctttggtaaaacacgga
ttattttctttggatatcttggaaaccctttttttaaatagggctccaacttttgacaaa
ggatatataactgcataccttcccgattataaaactttagctgaaataacgaagctctac
aaaaacagcgttactaaagatgcaagtgacagcgagaatgctaatatgattttatgctct
ttgcgatttttaatcaccaattttgaaaaagacaaaaggcatggttcgaagtacaaaaat
atcaataactggacggatgatcaggaacaagcgttccaaaagaaactacaggataatatc
ttaggtattttccaagttttttcgagtgacatacatgatgttgaaggccgcaccacttac
tacgaaaagttaagggttatcaatggcatttcttttcttatcatatatgcccccaaaaaa
tcaataatttccgcattagcccagattagtatttgtttgcaaacaggacttgggcttaag
gaagttcgatacgaggcctttagatgttggcatctgttagttcgccatctaaatgatgaa
gaactctctactgttatagatagcttaattgcattcatacttcaaaagtggtctgagttc
aacggaaaacttcgaaatatagtgtacagtatactggataccttaatcaaagagaaatcg
gacctgattttgaaattaaaaccttacactactttggctttagtaggcaagcctgaatta
ggtattttagctcgtgatggccaatttgcaagaatggtgaataaaataagaagtaccacg
gaccttatacccatatttgctaataacttgaaaagtagtaacaagtatgtcataaaccaa
aatttagacgatatagaggtatatcttcggagaaagcagacagaaagatcgattgatttt
acaccaaagaaggttgggcaaacttctgatataacattagttttgggtgctttattagac
acttctcataagtttagaaatttagacaaggacctatgcgagaagtgcgccaaatgtatc
agtatgattggtgttttagacgttacaaagcatgagtttaaaagaacaacatattcagaa
aacgaagtttatgatttgaatgatagtgttcaaactattaagttcttgatatgggtcata
aatgatatcctcgttcctgcgttttggcaaagtgagaatcccagcaagcaattgtttgtt
gcccttgtcatacaggaatcattaaaatattgcgggctaagttcagagtcatgggatatg
aaccataaagaattatatccaaatgaagccaaactatgggaaaagtttaactctgtctcc
aagacaaccatctatccgcttttatcttccttgtatcttgcgcaatcatggaaagaatat
gtcccgctaaaatatccttctaataacttcaaggaaggatacaaaatttgggtgaaaagg
tttacattggatttattgaaaacaggtacaacagaaaatcatccattacacgtgttttcc
tctttgattagggaagatgatggctcactatcaaattttttgctaccttatatttctctg
gacattattatcaaggcagaaaaaggaactccatacgctgatattttaaacgggattatt
attgaatttgacagcattttcacgtgcaatctggaaggaatgaataacttgcaagtggat
tcgttaagaatgtgctatgaatccatcttcagagttttcgaatattgcaaaaaatgggca
actgagtttaaacaaaattacagtaaactacacggcacttttatcattaaagatacgaaa
acaactaacatgcttttgagaatagatgagtttttgcgaacaaccccttcagatttgcta
gctcaacgctccttagagacggattcttttgaaaggtctgctctataccttgaacagtgc
tatcgacagaatcctcacgataagaaccaaaatggacaactactgaaaaatttacaaatc
acatacgaagaaataggagacattgactcactcgatggtgtactgagaacctttgctaca
ggaaacttggtttctaaaattgaagaattgcaatattctgaaaactggaaactcgcacaa
gactgctttaatgtcctcggcaaattttcagatgaccccaaaactacaaccaggatgcta
aagtctatgtatgaccaccaattgtattctcaaataatatcgaactcttcgttccattct
tcagacggaaaaatttctttgtctccagatgtgaaggaatggtacagcataggtcttgaa
gctgcaaatctagaaggcaatgttcaaactttgaaaaattgggtagaacaaatagagagt
ttaagaaatattgacgatagagaagtacttttgcagtacaatattgcgaaagctttaatt
gccatctcaaacgaggatccattaaggactcaaaaatacatccacaattcctttaggctt
atcggaacaaattttataacgtcatctaaagagacgacgctgctaaagaaacagaattta
ttgatgaaattacacagtttatatgacctcagttttttatcttctgcgaaagataagttt
gaatacaaaagtaacactaccatactcgattatcgaatggaacgtattggggctgacttc
gtgccaaatcattacatattgtcaatgagaaagtcatttgaccaattgaaaatgaatgaa
caagcagacgctgacttaggaaaaacattcttcactttagcccaattggcgagaaacaac
gctaggctagatatagcctccgaatcattaatgcattgtttggaaaggcggttgcctcag
gcagagttggagtttgctgaaatactatggaagcaaggtgagaatgatagagccttaaag
atagtgcaagaaatacatgaaaagtatcaagaaaattcctcggttaatgctcgcgatcgt
gccgccgtgctattaaagtttactgaatggttagacctttcgaacaattcagcgtccgaa
caaattattaaacaatatcaggatatttttcagattgattctaaatgggataaaccatat
tactctattggcttatactatagtagactacttgagcgcaaaaaagcagagggttatatt
actaatggtcgttttgagtacagggcaatatcttactttttattggcatttgaaaagaac
actgctaaagtaagagaaaatttgcccaaagttatcacgttttggctagatattgcggcc
gcatcaatttctgaagctcctggaaacagaaaggaaatgctgagtaaggctacggaagat
atatgtagtcatgttgaagaagcgctgcagcattgtcccacttatatttggtactttgtt
ttgactcagttgttatctaggttattacattctcatcaatcatcggcccagataataatg
cacatactgctaagtttggctgttgaatacccctctcatattttatggtatatcacagcc
cttgtaaattccaattcttcaaaaagagttcttcgtggtaagcatattttagaaaagtat
agacaacattcgcaaaatcctcatgatctagtttctagtgcattggatttaacgaaagca
ttaactcgtgtctgtttgcaagatgtcaaaagcattacaagtagatcaggcaaatcttta
gaaaaagacttcaaatttgacatgaacgtggccccatctgcaatggttgttccagtaaga
aaaaatttagacatcatttcaccactagagtctaactcaatgaggggctatcaaccattt
aggccggttgtttctataattagattcggatcatcttataaagtgttttcttcattaaag
aagccaaaacaattgaacataataggttcagatggcaacatttatgggatcatgtgtaag
aaggaagatgtccgacaagataaccaatatatgcagttcgccacaacaatggattttctt
ctgagtaaggacatagcttcaagaaaaagaagcctgggcataaatatttactccgtacta
tctcttcgagaagactgtgggatattggaaatggtaccgaatgttgtaactttaagatct
attctttctacaaagtacgaaagtctgaaaattaagtatagcctgaaaagtctacatgat
aggtggcagcacaccgcagtagatggaaaactcgagttttacatggaacaggtagataaa
tttcctccaatcttgtaccaatggtttttagaaaactttcctgatccaatcaattggttc
aacgccaggaatacgtatgccagatcttacgccgtcatggcaatggttggccatatatta
ggtctaggtgataggcactgtgaaaacatattactagatatacagacgggtaaagttctt
catgtagacttcgactgtttatttgagaaaggcaaaaggttacctgtcccagaaattgtt
cccttcagactaacaccaaatttattggatgcgttgggcataattgggacagaaggaaca
tttaagaagtctagtgaagtcacgttggctttaatgagaaaaaatgaagtagcgttgatg
aatgtgatcgaaacaattatgtacgatagaaacatggaccactcaattcaaaaagcgcta
aaggtcttaagaaacaaaatccgcggtatagatccgcaggatggcctggtattgagtgtt
gctggccaaacagaaacattgatccaagaagcaacatcagaagacaatctaagcaagatg
tatattggttggcttccattttggtaa

DBGET integrated database retrieval system