KEGG   Saccharomyces cerevisiae (budding yeast): YBR160WHelp
Entry
YBR160W           CDS       T00005                                 

Gene name
CDC28, CDK1, HSL5, SRM5
Definition
cyclin-dependent serine/threonine-protein kinase CDC28 (EC:2.7.11.22)
Orthology
K04563  
cyclin-dependent kinase [EC:2.7.11.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR160W (CDC28)
   04113 Meiosis - yeast
    YBR160W (CDC28)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     YBR160W (CDC28)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:560078..560974
Genome map
AA seq 298 aa AA seqDB search
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaattagcaaattacaaaagacttgagaaagtcggtgaaggtacatacggt
gttgtttataaagcgttagacttaagacctggccaaggtcaaagagtagtcgcattgaag
aaaataagactagagagtgaagacgagggtgttcccagtacagccatcagagaaatctca
ttattgaaggaattaaaagacgataatattgtcagattatacgatattgttcactctgat
gcacacaagctatatcttgtttttgagttcctcgatttggacctgaaaagatatatggag
ggtattccaaaggaccaaccgttaggagctgatattgttaagaagtttatgatgcaactt
tgtaagggtattgcatactgccactcacaccgtattctgcatcgtgatttaaaaccgcag
aacttattgattaacaaagatgggaatctaaaactaggtgattttggcttagcgcgtgct
tttggtgttccgttgagagcttacacacatgaaattgttactctatggtatagagctccg
gaggtattactgggtggaaaacaatatagtacaggtgtcgatacatggtccatcggctgt
atatttgccgaaatgtgtaacaggaaaccaatcttcagtggcgatagtgagatcgatcag
attttcaagatattcagagtattgggaacgccgaatgaagctatatggccagatattgtc
tacttgcctgatttcaagccaagctttcctcaatggcgcagaaaagacctatcacaagtg
gtaccaagtctagatccacgcggtattgatttgttggacaaactcctcgcgtatgaccct
attaaccggattagcgccagaagagcagccatccacccctacttccaagaatcataa

DBGET integrated database retrieval system