KEGG   Saccharomyces cerevisiae (budding yeast): YBR160WHelp
Entry
YBR160W           CDS       T00005                                 

Gene name
CDC28, CDK1, HSL5, SRM5
Definition
Cdc28p (EC:2.7.11.22)
Orthology
K04563  
cyclin-dependent kinase [EC:2.7.11.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:560078..560974
Genome map
AA seq 298 aa AA seqDB search
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaattagcaaattacaaaagacttgagaaagtcggtgaaggtacatacggt
gttgtttataaagcgttagacttaagacctggccaaggtcaaagagtagtcgcattgaag
aaaataagactagagagtgaagacgagggtgttcccagtacagccatcagagaaatctca
ttattgaaggaattaaaagacgataatattgtcagattatacgatattgttcactctgat
gcacacaagctatatcttgtttttgagttcctcgatttggacctgaaaagatatatggag
ggtattccaaaggaccaaccgttaggagctgatattgttaagaagtttatgatgcaactt
tgtaagggtattgcatactgccactcacaccgtattctgcatcgtgatttaaaaccgcag
aacttattgattaacaaagatgggaatctaaaactaggtgattttggcttagcgcgtgct
tttggtgttccgttgagagcttacacacatgaaattgttactctatggtatagagctccg
gaggtattactgggtggaaaacaatatagtacaggtgtcgatacatggtccatcggctgt
atatttgccgaaatgtgtaacaggaaaccaatcttcagtggcgatagtgagatcgatcag
attttcaagatattcagagtattgggaacgccgaatgaagctatatggccagatattgtc
tacttgcctgatttcaagccaagctttcctcaatggcgcagaaaagacctatcacaagtg
gtaccaagtctagatccacgcggtattgatttgttggacaaactcctcgcgtatgaccct
attaaccggattagcgccagaagagcagccatccacccctacttccaagaatcataa

DBGET integrated database retrieval system