KEGG   Saccharomyces cerevisiae (budding yeast): YBR202WHelp
Entry
YBR202W           CDS       T00005                                 

Gene name
MCM7, CDC47
Definition
Mcm7p (EC:3.6.4.12)
Orthology
K02210  
DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YBR202W (MCM7)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR202W (MCM7)
   04113 Meiosis - yeast
    YBR202W (MCM7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YBR202W (MCM7)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YBR202W (MCM7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:625772..628309
Genome map
AA seq 845 aa AA seqDB search
MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKG
PKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRA
IDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDA
LREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLIT
VRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFM
STRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPY
TGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAP
EIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRG
VYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEV
MEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLM
LDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYV
VQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLV
RVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLS
NCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDI
DLQDA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcacttccatcaattcagcttcctgtcgactataataatctttttaatgaa
atcaccgattttttggtgactttcaagcaggatacgttgtcttctgatgcaacacgaaat
gagaacgaagatgaaaatttggatgctgagaatatcgaacaacatctattggaaaagggg
cccaagtacatggcgatgctacagaaagtggctaatagggaactgaattccgtgattatt
gatttagatgacattctacagtatcaaaacgaaaagtttctccagggcacacaggcagac
gaccttgtgtctgccattcaacaaaacgctaatcacttcactgaattattttgccgtgcc
attgacaacaacatgccgctaccaacaaaagaaattgactacaaggacgacgttcttgat
gttattttaaaccaaaggagactgaggaatgagagaatgctctcggacaggaccaatgag
atccgaagcgaaaacctcatggataccacgatggatccaccctcttccatgaatgatgcg
ttaagagaagttgtcgaggatgaaactgagttatttcctcctaatttaactagacgctat
ttcctttattttaagcctctatcgcaaaattgtgctcgtcgttacaggaagaaagcaatt
agttctaaaccattatctgttaggcagattaaaggtgacttcctaggccaattgattacc
gtcagaggtattatcaccagagtttctgatgtcaaaccagctgtggaagttatcgcatat
acctgcgatcaatgtgggtacgaagttttccaagaggtcaactctcgtacttttactccg
ttgtcagaatgtacttccgaagaatgttcccaaaatcaaacaaagggtcaattgtttatg
agtacacgagcttccaaatttagtgcctttcaggaatgtaaaattcaggagttatcacaa
caagtgccagtgggtcatattcctaggtcgctaaatatccacgttaacgggacgctggta
agatctttatcgcctggtgatatcgtcgatgtaactggtatattcttgccagcgccctac
accggtttcaaagctttgaaagctggcttactgacagaaacttatttagaggcacagttt
gtccgtcaacacaagaagaaatttgcgtctttcagtctgacttctgatgtagaagagaga
gttatggaattaatcacctctggtgatgtttataataggctggcaaaatctattgcaccg
gaaatctacggtaacttggacgtaaagaaagcgttgctgctattacttgtcggaggtgtt
gataaaagggtaggtgacggtatgaaaatcagaggtgatatcaatgtttgtctgatgggt
gatcccggtgttgccaaatctcaactgctgaaggccatttgcaaaatatcacctcgagga
gtgtataccactggtaagggttcctcaggcgttggtctgaccgctgccgtcatgaaagat
cctgtcacggatgaaatgattctagaaggtggtgccttagtactcgctgataacggtatt
tgttgtatcgatgaatttgataagatggatgaaagtgacagaacggcaatccatgaagtt
atggaacaacaaacaatttcgatatccaaggcgggtatcaatacaactttgaacgccaga
acctcaatcttagcggcagcaaatccgttgtatggtagatataatcctagattatcacct
ctggacaatataaatctaccagctgctttactatccagatttgatattctcttcttaatg
ttagatataccaagtagagatgacgacgaaaaattagccgagcacgttacatatgtgcat
atgcataataaacaaccggatttggacttcactccagtagaaccctctaaaatgagagag
tacattgcctatgctaagacaaagaggccagtgatgagtgaagctgtaaacgattatgtg
gtgcaagcttacatcagattaagacaagactccaagagagaaatggattccaaattttcc
tttggtcaagccactccgagaactttactaggtattataagattatctcaagcgctagca
aagttaaggttggctgatatggtggatatagatgatgtggaggaagccttgaggttggtc
cgagtctccaaggaatcattgtatcaagaaaccaacaaatctaaagaagatgaaagcccc
acaacgaaaatctttacgatcatcaagaaaatgttacaagaaactggtaaaaacacgcta
tcatatgaaaatattgtgaaaactgtaagactaagagggtttaccatgctacaattaagc
aactgtatccaagaatattcttacttaaacgtctggcatttaattaatgagggtaacact
ttgaaattcgtggatgacggtaccatggacacagaccaggaagactcactagtgagcacg
cctaaactcgcaccacaaacgaccgcttccgctaatgtgagcgcccaagattctgatatc
gatctacaagacgcttga

DBGET integrated database retrieval system