KEGG   Saccharomyces cerevisiae (budding yeast): YBR237WHelp
Entry
YBR237W           CDS       T00005                                 

Gene name
PRP5, RNA5
Definition
(RefSeq) DEAD-box RNA helicase PRP5
  KO
K12811  
ATP-dependent RNA helicase DDX46/PRP5 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    YBR237W (PRP5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YBR237W (PRP5)
Spliceosome [BR:sce03041]
 Complex A
  U2 snRNP components
   U2 related factors
    YBR237W (PRP5)
 Complex B
    YBR237W (PRP5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:691969..694518
Genome map
AA seq 849 aa AA seqDB search
METIDSKQNINRESLLEERRKKLAKWKQKKAQFDAQKEHQTSRNDIVTNSLEGKQTTEKF
TERQERVKEELRKRKNEFRKSDEPVSVKPSKKKSKRSKVKKKISFDFSDDDDSEIGVSFR
SKEHIQKAPEHDNEKDPLDEFMTSLKEEKMSNSKGMYDRGDILDVEDQLFELGGTDDEDV
EDNTDNSNIAKIAKLKAKKRVKQIYYSPEELEPFQKNFYIESETVSSMSEMEVEELRLSL
DNIKIKGTGCPKPVTKWSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGIS
KTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSI
RSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDILTLNDGKLLSTKRITFVVMDEADRL
FDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVK
QKFRICHSEDEKFDNLVQLIHERSEFFDEVQSENDGQSSDVEEVDAKAIIFVSSQNICDF
ISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIY
NAVKTFAQYVHTTGRTARGSRSGTAITLLLHDELSGAYILSKAMRDEEIKALDPLQAKEL
QEMSAKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNKDLELKKNDKRSDDLEKKISN
PREGHDSVSESSALIPRLNYELFKESTDGSIIFYAKVYINDLPQIVRWEATKNTTLLFIK
HETGCSITNKGKFYPEGKEPKNENDEPKLYLLIEGQDEKDIQLSIELLEQKVKEGVVKAA
SLSLKSTKY
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgattcgaagcaaaatattaatagggagtctttattggaggaaaggagg
aaaaaactagcaaaatggaaacaaaaaaaagcacaatttgatgctcagaaagagcatcaa
acttcacgcaatgacattgttactaacagtttagaaggtaagcagactactgaaaagttt
acggaaagacaggaacgtgtaaaagaagagcttcggaagagaaaaaatgaatttaggaaa
tctgacgaacctgtatcggttaagccttcgaagaaaaagtcgaagagaagtaaggtaaag
aagaaaatatccttcgacttcagtgatgacgatgattctgaaataggagtttcttttaga
tcgaaggagcacattcaaaaagctccagagcatgataatgaaaaagatccactggatgag
tttatgacgtcattgaaggaggagaaaatgagtaatagtaaaggcatgtacgacagaggc
gacattcttgatgtagaggatcaattgtttgaacttggaggaaccgacgatgaggatgtt
gaagataatacggataattctaatatagcgaaaattgctaaactcaaagcaaaaaaacgt
gtaaagcaaatttattactctccagaagagcttgagccgttccaaaaaaatttttatata
gaatctgaaacagtttcctcgatgtcagagatggaagttgaggagcttagacttagtctg
gataatatcaaaataaagggaacaggttgccccaaaccagtcacaaagtggtctcaactg
ggactatcaacggacaccatggttttaattacagaaaagttgcactttggctccttaacg
cctattcaatcccaggctcttcccgctattatgtcaggtcgtgatgttataggaatatca
aaaactggctccggcaagaccatctcctatcttttaccattgctaagacaagtaaaagct
caacggccattatcaaaacatgaaacagggcccatgggtttaattctggctccaactaga
gagctagctttacaaatacatgaagaagttactaaattcacagaagcagatacatccatt
agatcagtatgctgtacaggaggttctgaaatgaaaaagcagattactgatcttaaaaga
ggcactgagattgttgttgccacaccgggacgatttattgatatattaacactaaatgat
gggaaattacttagtactaaaagaataacgttcgtagtaatggatgaggcagacaggctg
ttcgatttaggttttgaacctcaaataacgcaaatcatgaaaactgttcgaccggataaa
cagtgtgttctatttagtgcaacttttccgaacaaactacgcagttttgccgtaagagtt
ttgcattccccaatatctattacgattaattcaaagggaatggttaatgaaaacgtaaaa
caaaagtttagaatatgccattcagaagatgaaaaatttgacaatctggtgcagcttatc
catgagcgcagtgaattttttgacgaggttcaaagtgaaaatgacggacagtcaagcgat
gttgaagaagttgatgctaaagccattatatttgtatcaagtcagaatatttgcgacttc
atttcaaaaaagctgttaaatgctggaattgtgacctgtgctattcatgcaggtaagcca
tatcaagaaaggcttatgaacttagaaaagttcaaacgagaaaagaacagtattcttctc
tgtacagaggttctctcaagaggtttaaatgttcccgaagtgtcgttggttattatctat
aacgccgtcaaaactttcgcgcaatatgttcatactactggaagaactgccagaggtagt
cgctccggtactgctattactcttctattgcatgatgaactgtcaggtgcttatatcttg
agcaaggcaatgcgcgatgaagaaataaaagctttagaccctctgcaagcaaaagaactt
caggaaatgagtgccaagtttgaatccggtatgaaaaagggtaagtttaggttgtcgaaa
gggttcggcggcaaaggactggaaaatatcaaaagtaaaagagaggaagctcaaaataaa
gatttggagctcaaaaagaatgataagaggagcgatgacttggaaaagaaaatcagcaat
ccacgcgaagggcatgacagtgtgtctgagtcttctgcgcttattccgagactcaattat
gaactattcaaagagtctacagacgggtcgatcatcttttacgccaaggtttatattaat
gatttaccccagattgtaagatgggaggctacaaagaatacaaccttattatttatcaag
catgaaaccggatgtagtattactaacaagggtaaattttaccctgaagggaaggaacca
aagaatgaaaacgatgagcctaaactatacttattgatcgaaggccaagatgagaaagac
atacaattaagtatagaattgctggagcaaaaagttaaagagggggtcgtaaaggctgca
agcttgtctttgaagagtactaaatactag

DBGET integrated database retrieval system