KEGG   Saccharomyces cerevisiae (budding yeast): YBR274WHelp
Entry
YBR274W           CDS       T00005                                 

Gene name
CHK1
Definition
(RefSeq) serine/threonine protein kinase CHK1
  KO
K02216  serine/threonine-protein kinase Chk1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Module
sce_M00691  DNA damage-induced cell cycle checkpoints
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBR274W (CHK1)
   04113 Meiosis - yeast
    YBR274W (CHK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YBR274W (CHK1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   YBR274W (CHK1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    YBR274W (CHK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 852577
NCBI-ProteinID: NP_009833
SGD: S000000478
UniProt: P38147
Position
II:749594..751177
Genome map
AA seq 527 aa AA seqDB search
MSLSQVSPLPHIKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIHVPTCKKMGLSDK
DITKEVVLQSKCSKHPNVLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQF
YFQQLVSAINYLHVECGVAHRDIKPENILLDKNGNLKLADFGLASQFRRKDGTLRVSMDQ
RGSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWELPSLENEDFVFFIENDG
NLNWGPWSKIEFTHLNLLRKILQPDPNKRVTLKALKLHPWVLRRASFSGDDGLCNDPELL
AKKLFSHLKVSLSNENYLKFTQDTNSNNRYISTQPIGNELAELEHDSMHFQTVSNTQRAF
TSYDSNTNYNSGTGMTQEAKWTQFISYDIAALQFHSDENDCNELVKRHLQFNPNKLTKFY
TLQPMDVLLPILEKALNLSQIRVKPDLFANFERLCELLGYDNVFPLIINIKTKSNGGYQL
CGSISIIKIEEELKSVGFERKTGDPLEWRRLFKKISTICRDIILIPN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagtctctcgcaggtgtcacctttaccccatatcaaggatgttgttttaggagataca
gtaggccaaggcgcattcgcctgcgttaaaaatgctcatcttcaaatggatccctccatt
attctagctgttaaattcattcatgttcccacttgcaaaaaaatgggactcagtgacaag
gatatcacaaaagaggttgttttgcaatcgaagtgttctaagcatcctaatgttttgaga
cttatcgattgtaatgtctctaaagaatatatgtggataattctggagatggcagatggt
ggtgatctatttgataagattgagcctgacgttggagttgattccgacgtggcccaattt
tactttcaacagctcgttagtgctattaattatctgcatgtagaatgtggagttgctcac
agagacatcaagcctgaaaacatcttactcgataagaacggaaatctgaagctagctgat
tttgggctcgcctctcaatttaggaggaaagatggtacattacgtgtatccatggatcaa
aggggttctccaccctacatggctcctgaagtattatattctgaagagggttattacgca
gatcgaacagatatatggtctattggcatcctcttgttcgtattgttgactggtcaaacg
ccttgggaattaccttcattagagaacgaagatttcgtcttttttattgaaaatgatgga
aatttaaactggggaccctggtcaaagatagaatttactcacttgaacctactccgaaaa
attttacaacctgacccaaataagagggtgacattgaaggctttaaagttacatccttgg
gtattacgtcgagcttcattttctggggatgatggtctctgtaatgaccctgaactcttg
gctaagaaactgttttctcacttaaaagtctcactgagtaacgaaaattatttgaaattc
actcaagatacaaactctaataataggtacatttctactcagccaattggtaacgaattg
gctgagcttgaacacgactcaatgcatttccagacagtttcgaatacacaacgtgcattt
acctcgtatgattcaaatacgaactataatagcggaacaggtatgacacaagaggctaag
tggacgcaattcataagctatgatatcgctgccttacagtttcattctgatgaaaatgat
tgtaatgaattagtaaaacgacatttacaatttaatccgaataaacttaccaagttctac
acgttgcaacctatggatgttttgttaccgattttggagaaagccttgaatttatcacaa
attagagtaaaacccgacctttttgcgaattttgaaagattgtgcgaattattgggttat
gataacgttttcccacttattataaatattaaaaccaaaagtaatgggggttatcaatta
tgcggtagcatttccatcataaagattgaagaagagttgaaaagtgtcggatttgaaaga
aaaactggtgatcctttagaatggagaagattgttcaagaaaatttcaactatctgtagg
gatattatcctaattcccaactga

DBGET integrated database retrieval system