KEGG   Saccharomyces cerevisiae (budding yeast): YBR274WHelp
Entry
YBR274W           CDS       T00005                                 

Gene name
CHK1
Definition
Chk1p (EC:2.7.11.1)
Orthology
K02216  
serine/threonine-protein kinase Chk1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:749594..751177
Genome map
AA seq 527 aa AA seqDB search
MSLSQVSPLPHIKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIHVPTCKKMGLSDK
DITKEVVLQSKCSKHPNVLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQF
YFQQLVSAINYLHVECGVAHRDIKPENILLDKNGNLKLADFGLASQFRRKDGTLRVSMDQ
RGSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWELPSLENEDFVFFIENDG
NLNWGPWSKIEFTHLNLLRKILQPDPNKRVTLKALKLHPWVLRRASFSGDDGLCNDPELL
AKKLFSHLKVSLSNENYLKFTQDTNSNNRYISTQPIGNELAELEHDSMHFQTVSNTQRAF
TSYDSNTNYNSGTGMTQEAKWTQFISYDIAALQFHSDENDCNELVKRHLQFNPNKLTKFY
TLQPMDVLLPILEKALNLSQIRVKPDLFANFERLCELLGYDNVFPLIINIKTKSNGGYQL
CGSISIIKIEEELKSVGFERKTGDPLEWRRLFKKISTICRDIILIPN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagtctctcgcaggtgtcacctttaccccatatcaaggatgttgttttaggagataca
gtaggccaaggcgcattcgcctgcgttaaaaatgctcatcttcaaatggatccctccatt
attctagctgttaaattcattcatgttcccacttgcaaaaaaatgggactcagtgacaag
gatatcacaaaagaggttgttttgcaatcgaagtgttctaagcatcctaatgttttgaga
cttatcgattgtaatgtctctaaagaatatatgtggataattctggagatggcagatggt
ggtgatctatttgataagattgagcctgacgttggagttgattccgacgtggcccaattt
tactttcaacagctcgttagtgctattaattatctgcatgtagaatgtggagttgctcac
agagacatcaagcctgaaaacatcttactcgataagaacggaaatctgaagctagctgat
tttgggctcgcctctcaatttaggaggaaagatggtacattacgtgtatccatggatcaa
aggggttctccaccctacatggctcctgaagtattatattctgaagagggttattacgca
gatcgaacagatatatggtctattggcatcctcttgttcgtattgttgactggtcaaacg
ccttgggaattaccttcattagagaacgaagatttcgtcttttttattgaaaatgatgga
aatttaaactggggaccctggtcaaagatagaatttactcacttgaacctactccgaaaa
attttacaacctgacccaaataagagggtgacattgaaggctttaaagttacatccttgg
gtattacgtcgagcttcattttctggggatgatggtctctgtaatgaccctgaactcttg
gctaagaaactgttttctcacttaaaagtctcactgagtaacgaaaattatttgaaattc
actcaagatacaaactctaataataggtacatttctactcagccaattggtaacgaattg
gctgagcttgaacacgactcaatgcatttccagacagtttcgaatacacaacgtgcattt
acctcgtatgattcaaatacgaactataatagcggaacaggtatgacacaagaggctaag
tggacgcaattcataagctatgatatcgctgccttacagtttcattctgatgaaaatgat
tgtaatgaattagtaaaacgacatttacaatttaatccgaataaacttaccaagttctac
acgttgcaacctatggatgttttgttaccgattttggagaaagccttgaatttatcacaa
attagagtaaaacccgacctttttgcgaattttgaaagattgtgcgaattattgggttat
gataacgttttcccacttattataaatattaaaaccaaaagtaatgggggttatcaatta
tgcggtagcatttccatcataaagattgaagaagagttgaaaagtgtcggatttgaaaga
aaaactggtgatcctttagaatggagaagattgttcaagaaaatttcaactatctgtagg
gatattatcctaattcccaactga

DBGET integrated database retrieval system