KEGG   Saccharomyces cerevisiae (budding yeast): YBR279WHelp
Entry
YBR279W           CDS       T00005                                 

Gene name
PAF1
Definition
Paf1p
Orthology
K15174  
RNA polymerase II-associated factor 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    PAF1 complex
     YBR279W (PAF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
II:761257..762594
Genome map
AA seq 445 aa AA seqDB search
MSKKQEYIAPIKYQNSLPVPQLPPKLLVYPESPETNADSSQLINSLYIKTNVTNLIQQDE
DLGMPVDLMKFPGLLNKLDSKLLYGFDNVKLDKDDRILLRDPRIDRLTKTDISKVTFLRR
TEYVSNTIAAHDNTSLKRKRRLDDGDSDDENLDVNHIISRVEGTFNKTDKWQHPVKKGVK
MVKKWDLLPDTASMDQVYFILKFMGSASLDTKEKKSLNTGIFRPVELEEDEWISMYATDH
KDSAILENELEKGMDEMDDDSHEGKIYKFKRIRDYDMKQVAEKPMTELAIRLNDKDGIAY
YKPLRSKIELRRRRVNDIIKPLVKEHDIDQLNVTLRNPSTKEANIRDKLRMKFDPINFAT
VDEEDDEDEEQPEDVKKESEGDSKTEGSEQEGENEKDEEIKQEKENEQDEENKQDENRAA
DTPETSDAVHTEQKPEEEKETLQEE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaaacaggaatatattgcaccaataaaataccaaaacagcttgcctgtgcca
caattacctcctaaacttctggtttaccccgagtctccggagacgaatgcagactcctcc
caactaatcaattcactatacatcaaaacaaacgtcactaatctaattcaacaggatgaa
gatttaggtatgccggttgatttgatgaaattcccaggcctattgaacaaattagattct
aaactgctttacggctttgataatgtgaaattggacaaagatgatcgaattttactgagg
gaccctagaatagatagactgaccaagactgatatatcaaaggttaccttcttgagacgc
accgaatatgtctccaatacaattgcagcccatgataacacatcgttgaaaaggaaaagg
cgcttggatgatggagattcggatgatgaaaaccttgatgttaatcatataattagtagg
gtcgaaggaacattcaataagacggacaaatggcaacatccggtgaagaagggtgtcaag
atggttaaaaaatgggacctattgcccgacacagcttcaatggaccaggtgtattttatc
ctaaaattcatgggcagtgcatcattggatactaaagaaaaaaaatctttaaatacagga
attttcaggccagtggaactggaagaagacgaatggatttccatgtatgccacagatcat
aaggactctgccattctggaaaacgaattggaaaagggtatggatgaaatggatgatgac
tctcatgaaggtaaaatatacaagtttaaaaggataagagactacgacatgaaacaagtg
gctgaaaagccaatgacagagttagctatacgtttgaatgataaggacggcatagcttac
tacaaacccctacgttcaaagatcgaattaagacgtaggagagtaaacgacatcattaaa
cctttggtgaaggagcacgatatagaccaacttaatgttactttgagaaaccctagcact
aaggaagctaacataagggacaagttaagaatgaagtttgaccccataaatttcgccact
gtagatgaagaagacgatgaagacgaggagcaaccagaagacgttaagaaagaatcggaa
ggcgattcaaaaacagaaggttctgagcaagaaggagaaaatgagaaggatgaagaaatc
aaacaggaaaaagagaatgaacaagatgaagaaaataaacaagatgaaaaccgtgcagct
gatacgcccgaaacttcagatgctgttcatactgaacaaaaaccagaggaagaaaaggaa
actttacaagaagaatag

DBGET integrated database retrieval system