KEGG   Saccharomyces cerevisiae (budding yeast): YCL030CHelp
Entry
YCL030C           CDS       T00005                                 

Gene name
HIS4
Definition
trifunctional histidinol dehydrogenase/phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase (EC:3.6.1.31 3.5.4.19 1.1.1.23)
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sce01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sce00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
III:complement(65934..68333)
Genome map
AA seq 799 aa AA seqDB search
MVLPILPLIDDLASWNSKKEYVSLVGQVLLDGSSLSNEEILQFSKEEEVPLVALSLPSGK
FSDDEIIAFLNNGVSSLFIASQDAKTAEHLVEQLNVPKERVVVEENGVFSNQFMVKQKFS
QDKIVSIKKLSKDMLTKEVLGEVRTDRPDGLYTTLVVDQYERCLGLVYSSKKSIAKAIDL
GRGVYYSRSRNEIWIKGETSGNGQKLLQISTDCDSDALKFIVEQENVGFCHLETMSCFGE
FKHGLVGLESLLKQRLQDAPEESYTRRLFNDSALLDAKIKEEAEELTEAKGKKELSWEAA
DLFYFALAKLVANDVSLKDVENNLNMKHLKVTRRKGDAKPKFVGQPKAEEEKLTGPIHLD
VVKASDKVGVQKALSRPIQKTSEIMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSNPVL
NAPFPEEYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKV
GLYIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIV
LAGGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLV
IADEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVR
KCIAHSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCG
DYSSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGH
RNAVKIRMSKLGLIPKDFQ
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggttttgccgattctaccgttaattgatgatctggcctcatggaatagtaagaaggaa
tacgtttcacttgttggtcaggtacttttggatggctcgagcctgagtaatgaagagatt
ctccagttctccaaagaggaagaagttccattggtggctttgtccttgccaagtggtaaa
ttcagcgatgatgaaatcattgccttcttgaacaacggagtttcttctctgttcattgct
agccaagatgctaaaacagccgaacacttggttgaacaattgaatgtaccaaaggagcgt
gttgttgtggaagagaacggtgttttctccaatcaattcatggtaaaacaaaaattctcg
caagataaaattgtgtccataaagaaattaagcaaggatatgttgaccaaagaagtgctt
ggtgaagtacgtacagaccgtcctgacggtttatataccaccctagttgtcgaccaatat
gagcgttgtctagggttggtgtattcttcgaagaaatctatagcaaaggccatcgatttg
ggtcgtggcgtttattattctcgttctaggaatgaaatctggatcaagggtgaaacttct
ggcaatggccaaaagcttttacaaatctctactgactgtgattcggatgccttaaagttt
atcgttgaacaagaaaacgttggattttgccacttggagaccatgtcttgctttggtgaa
ttcaagcatggtttggtggggctagaatctttactaaaacaaaggctacaggacgctcca
gaggaatcttatactagaagactattcaacgactctgcattgttagatgccaagatcaag
gaagaagctgaagaactgactgaggcaaagggtaagaaggagctttcttgggaggctgcc
gatttgttctactttgcactggccaaattagtggccaacgatgtttcattgaaggacgtc
gagaataatctgaatatgaagcatctgaaggttacaagacggaaaggtgatgctaagcca
aagtttgttggacaaccaaaggctgaagaagaaaaactgaccggtccaattcacttggac
gtggtgaaggcttccgacaaagttggtgtgcagaaggctttgagcagaccaatccaaaag
acttctgaaattatgcatttagtcaatccgatcatcgaaaatgttagagacaaaggtaac
tctgcccttttggagtacacagaaaagtttgatggtgtaaaattatccaatcctgttctt
aatgctccattcccagaagaatactttgaaggtttaaccgaggaaatgaaggaagctttg
gacctttcaattgaaaacgtccgcaaattccatgctgctcaattgccaacagagactctt
gaagttgaaacccaacctggtgtcttgtgttccagattccctcgtcctattgaaaaagtt
ggtttgtatatccctggtggcactgccattttaccaagtactgcattaatgcttggtgtt
ccagcacaagttgcccaatgtaaggagattgtgtttgcatctccaccaagaaaatctgat
ggtaaagtttcacccgaagttgtttatgtcgcagaaaaagttggcgcttccaagattgtt
ctagctggtggtgcccaagccgttgctgctatggcttacgggacagaaactattcctaaa
gtggataagatcttgggtccaggtaatcaatttgtgactgccgccaaaatgtatgttcaa
aatgacactcaagctctatgttccattgatatgccagctggcccaagtgaagttttggtt
attgccgatgaagatgccgatgtggattttgttgcaagtgatttgctatcgcaagctgaa
cacggtattgactcccaagttatccttgttggtgttaacttgagcgaaaagaaaattcaa
gagattcaagatgctgtccacaatcaagctttacaactgccacgtgtggatattgttcgt
aaatgtattgctcacagtacgatcgttctttgtgacggttacgaagaagcccttgaaatg
tccaaccaatatgcaccagaacatttgattctacaaatcgccaatgctaacgattatgtt
aaattggttgacaatgcagggtccgtatttgtgggtgcttacactccagaatcgtgcggt
gactattcaagtggtactaaccatacattaccaacctatggttacgctaggcagtacagt
ggtgccaacactgcaaccttccaaaagtttatcactgcccaaaacattacccctgaaggt
ttagaaaacatcggtagagctgttatgtgcgttgccaagaaggagggtctagacggtcac
agaaacgctgtgaaaatcagaatgagtaagcttgggttgatcccaaaggatttccagtag

DBGET integrated database retrieval system