KEGG   Saccharomyces cerevisiae (budding yeast): YCL043CHelp
Entry
YCL043C           CDS       T00005                                 

Gene name
PDI1, MFP1, TRG1
Definition
protein disulfide isomerase PDI1 (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YCL043C (PDI1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YCL043C (PDI1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YCL043C (PDI1)
  Exosomal proteins of colorectal cancer cells
   YCL043C (PDI1)
  Exosomal proteins of bladder cancer cells
   YCL043C (PDI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
III:complement(48653..50221)
Genome map
AA seq 522 aa AA seqDB search
MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPW
CGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSI
DYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSM
ANKHFNDYDFVSAENADDDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPY
FGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR
HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGD
ASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELA
DTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI
KENGHFDVDGKALYEEAQEKAAEEADADAELADEEDAIHDEL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttctgctggtgccgtcctgtcatggtcctccctgctgctcgcctcctctgtt
ttcgcccaacaagaggctgtggcccctgaagactccgctgtcgttaagttggccaccgac
tccttcaatgagtacattcagtcgcacgacttggtgcttgcggagttttttgctccatgg
tgtggccactgtaagaacatggctcctgaatacgttaaagccgccgagactttagttgag
aaaaacattaccttggcccagatcgactgtactgaaaaccaggatctgtgtatggaacac
aacattccagggttcccaagcttgaagattttcaaaaacagcgatgttaacaactcgatc
gattacgagggacctagaactgccgaggccattgtccaattcatgatcaagcaaagccaa
ccggctgtcgccgttgttgctgatctaccagcttaccttgctaacgagacttttgtcact
ccagttatcgtccaatccggtaagattgacgccgacttcaacgccaccttttactccatg
gccaacaaacacttcaacgactacgactttgtctccgctgaaaacgcagacgatgatttc
aagctttctatttacttgccctccgccatggacgagcctgtagtatacaacggtaagaaa
gccgatatcgctgacgctgatgtttttgaaaaatggttgcaagtggaagccttgccctac
tttggtgaaatcgacggttccgttttcgcccaatacgtcgaaagcggtttgcctttgggt
tacttattctacaatgacgaggaagaattggaagaatacaagcctctctttaccgagttg
gccaaaaagaacagaggtctaatgaactttgttagcatcgatgccagaaaattcggcaga
cacgccggcaacttgaacatgaaggaacaattccctctatttgccatccacgacatgact
gaagacttgaagtacggtttgcctcaactctctgaagaggcgtttgacgaattgagcgac
aagatcgtgttggagtctaaggctattgaatctttggttaaggacttcttgaaaggtgat
gcctccccaatcgtgaagtcccaagagatcttcgagaaccaagattcctctgtcttccaa
ttggtcggtaagaaccatgacgaaatcgtcaacgacccaaagaaggacgttcttgttttg
tactatgccccatggtgtggtcactgtaagagattggccccaacttaccaagaactagct
gatacctacgccaacgccacatccgacgttttgattgctaaactagaccacactgaaaac
gatgtcagaggcgtcgtaattgaaggttacccaacaatcgtcttatacccaggtggtaag
aagtccgaatctgttgtgtaccaaggttcaagatccttggactctttattcgacttcatc
aaggaaaacggtcacttcgacgtcgacggtaaggccttgtacgaagaagcccaggaaaaa
gctgctgaggaagccgatgctgacgctgaattggctgacgaagaagatgccattcacgat
gaattgtaa

DBGET integrated database retrieval system