KEGG   Saccharomyces cerevisiae (budding yeast): YCL043CHelp
Entry
YCL043C           CDS       T00005                                 

Gene name
PDI1, MFP1, TRG1
Definition
protein disulfide isomerase PDI1 (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:sce04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
III:complement(48653..50221)
Genome map
AA seq 522 aa AA seqDB search
MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPW
CGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSI
DYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSM
ANKHFNDYDFVSAENADDDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPY
FGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR
HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGD
ASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELA
DTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI
KENGHFDVDGKALYEEAQEKAAEEADADAELADEEDAIHDEL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttctgctggtgccgtcctgtcatggtcctccctgctgctcgcctcctctgtt
ttcgcccaacaagaggctgtggcccctgaagactccgctgtcgttaagttggccaccgac
tccttcaatgagtacattcagtcgcacgacttggtgcttgcggagttttttgctccatgg
tgtggccactgtaagaacatggctcctgaatacgttaaagccgccgagactttagttgag
aaaaacattaccttggcccagatcgactgtactgaaaaccaggatctgtgtatggaacac
aacattccagggttcccaagcttgaagattttcaaaaacagcgatgttaacaactcgatc
gattacgagggacctagaactgccgaggccattgtccaattcatgatcaagcaaagccaa
ccggctgtcgccgttgttgctgatctaccagcttaccttgctaacgagacttttgtcact
ccagttatcgtccaatccggtaagattgacgccgacttcaacgccaccttttactccatg
gccaacaaacacttcaacgactacgactttgtctccgctgaaaacgcagacgatgatttc
aagctttctatttacttgccctccgccatggacgagcctgtagtatacaacggtaagaaa
gccgatatcgctgacgctgatgtttttgaaaaatggttgcaagtggaagccttgccctac
tttggtgaaatcgacggttccgttttcgcccaatacgtcgaaagcggtttgcctttgggt
tacttattctacaatgacgaggaagaattggaagaatacaagcctctctttaccgagttg
gccaaaaagaacagaggtctaatgaactttgttagcatcgatgccagaaaattcggcaga
cacgccggcaacttgaacatgaaggaacaattccctctatttgccatccacgacatgact
gaagacttgaagtacggtttgcctcaactctctgaagaggcgtttgacgaattgagcgac
aagatcgtgttggagtctaaggctattgaatctttggttaaggacttcttgaaaggtgat
gcctccccaatcgtgaagtcccaagagatcttcgagaaccaagattcctctgtcttccaa
ttggtcggtaagaaccatgacgaaatcgtcaacgacccaaagaaggacgttcttgttttg
tactatgccccatggtgtggtcactgtaagagattggccccaacttaccaagaactagct
gatacctacgccaacgccacatccgacgttttgattgctaaactagaccacactgaaaac
gatgtcagaggcgtcgtaattgaaggttacccaacaatcgtcttatacccaggtggtaag
aagtccgaatctgttgtgtaccaaggttcaagatccttggactctttattcgacttcatc
aaggaaaacggtcacttcgacgtcgacggtaaggccttgtacgaagaagcccaggaaaaa
gctgctgaggaagccgatgctgacgctgaattggctgacgaagaagatgccattcacgat
gaattgtaa

DBGET integrated database retrieval system