KEGG   Saccharomyces cerevisiae (budding yeast): YCL061CHelp
Entry
YCL061C           CDS       T00005                                 

Gene name
MRC1, YCL060C
Definition
Mrc1p
Orthology
K11272  
mediator of replication checkpoint protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YCL061C (MRC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
III:complement(18816..22106)
Genome map
AA seq 1096 aa AA seqDB search
MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATL
NRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSS
SFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQ
RIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGP
DTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREIQSELAS
EDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSNEDDDIKLENAHPKPVQNDD
ELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLDLDSDSDEYGDDDMD
SIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKAS
RKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKLEENDFQL
NAHDSGSDSGSESSGFALSGNEIADYESSGSENDNRRESDSEKEDDEIILKQKKSHHVKH
IINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVM
AERNTIENEVKDDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFE
MEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKM
INKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLV
KNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKP
VDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIK
SFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDK
FKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHRYHHDHHNKKMKMKTK
TKSNKLFESGQDSFDN
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgccttgcatgctttgtcctcgttgactgcaaagaagagaactaccacctac
aaaaaagttgctgttcccatactagatgagaacgataatactaatggaaatgggcccaat
gacatagacaatccgccagagttgactgggaacgggtttttatttgccaatgccacatta
aatcgtgttaagaacagattagaaggcaagaaagcacccgaacagaatcacaataatgga
aaagataggagtgagaattcgttaccaactcaattaatctctaatctttacgatggtggt
gaagagctggagaaatccgaagttaaagataatagttacagtgagaaaaatgtctcttct
tcattcacgcagacgcaaagaatacctgtcagcatccaacaagacaaggtgtttaacgta
cctatccattccgttaatgacgggaaacccacccaattaatcaaagaagatggtctcgtc
aacgaaacttctcaagcgctgaaaacacctctcacgacaggacggccaggggctacacag
cgtatagatagcagcggtgcaacctcacaaactcagcctataaaatcaattgaaccacaa
tcccaaataattacgacttccagcaatcattctaatgctctgtcgccgaaaattcctata
attccaacggaacttattggaactagtcctttatttcagtccattcaaaatcgtggtcct
gacacccaaatggatgtaccaccacagactgcgcatgatgaggataagacacaagcaatt
ggtattccacaggctacgcatcaggaacagaaaacccaaatagatacagtcgcacaaaca
cttcaagatgaagtaccacacacattaaaaattcgggaaatacaaagcgaattggcttca
gaagattctaaaagggaaaaagctagaaatgtcgaatacaaaaaaccgcaaaagccaata
ccaaccaaaaaatttttttctaaagagtcttttcttgctgattttgacgattcgtcctca
aatgaggacgatgatataaagctggaaaatgcacatccaaaaccagtacagaatgacgat
gaactgcatgagaacaaaagtgttgaattaaatctaactgatgagacaagaataaatgag
aaaagggttccactattgagctcctatgctaataatttgaaacgggaaattgactcctcg
aaatgcataacactggacctcgacagcgacagtgacgaatatggagatgatgatatggat
agcattaaattatccaaagatgaaagcgttttgccaatctctcagttatcaaaggcgact
atattaaacctgaaggcaagactctctaaacaaaatcaaaagttgtctcaaaggccgaat
aaaagtaaagacccaaaagttgatcataatgtactattaaataccttaaggaaagctagc
aggaaacaaattctggatcatcagaaagaagtgattgaaacgaaaggtctgaagctggag
gatatggccaaagaaaaggaaatagtagagaacttgctagaacaagaaattcttagaaat
aaaagaatcagacaaaaagagaagagaagggaaaaacttgaagaaaatgactttcaattg
aacgcccatgattccggttctgactcagggtcagagtcttctggatttgcattgagtggt
aatgaaattgccgattatgaatcatctggtagtgaaaatgacaatcgtagagaatccgat
agtgaaaaggaagatgatgaaattattctaaagcaaaaaaaatcccaccacgtgaaacat
atcattaacgaatcagactctgataccgaagtcgaagccaaacccaaagagaaagctgat
gaaagtctaccgaaaaggatcgccattaatctgggccattacggtgataatatcggagag
gataccgacaaatttcaagaaaccaatgttctagatacacaaaacattgaagaggtgatg
gccgaaagaaatacaatcgaaaatgaagtcaaagatgatgtatacgtcaatgaagaagct
gatgaagcaattcgccgtcagctgattgacaaagagaaattgcaactaaaacagaaagaa
aaggagcacgaggctaagataaaagagttgaagaaaagaggtgtcacaaacttctttgaa
atggaagccgaagaatccgaggatgaatggcatggtatcggtggtgcagatggagaagga
tctgacgactatgattctgacctagaaaaaatgatcgatgattattccaagaacaatttc
aatcctcatgaaatcagagaaatgcttgccgcagaaaataaggaaatggatatcaaaatg
ataaacaaaattctttatgacattaaaaatggaggatttcgtaataaaagagcaaaaaat
agcttagagctagaactaagtgatgatgatgaagacgacgtactacaacaatatcgtctc
aaaaggagagaattgatgagaaaaaggagattagaaattggcgatgatgcaaagcttgtt
aaaaacccaaagtcgagcgcattttttgaaagtatggtggaagatattatcgaatataaa
aaccccttcggggctgaagaggaatataacctagacattacaagtacggctactgaccta
gatactcaggacaatagcattaatgtaggtgataatacgggaaataatgaacagaaacct
gtagatcaaaagaacaaaaaggttatcatatctgaagactttgtgcagaaaagcttatcc
ttcctaaaaagtaataattatgaggattttgaaacggataaggagctatcaaggatacaa
catggcaatgatgaagcaattgaagatttatataccctaaaacagaatagttcgataaag
tcattcacaaattctcaaactgattcgaccacttcaaaaacagtaaacacaataattgac
ttagaaaagcgcccagaggatgaagatgaggtggaaaatggagatacatcactagttggc
gttttcaaacatccatcaataatcaaatcctttgcgtccagaacagacataaatgataag
tttaaagaaggtaacaagacagtcaagattctaaagtcttacaagacagtggggagttca
aaagcttctatcacatatatggggaaaacgagaaaattaatagcaccaaagaggaaaact
gaagggagccaccgctaccaccatgaccatcataataaaaaaatgaaaatgaaaacgaaa
acaaaatcgaataaactttttgaaagcggacaagatagctttgataattag

DBGET integrated database retrieval system